CATH Domain: 2ozhA01 XML data for domain: 2ozhA01

Molscript image for 2ozhA01
2ozhA01
PDB coordinates for domain 2ozhA01

PDB 2ozh, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.630 Aminopeptidase
3.40.630.30 Gene3D
3.40.630.30.22
3.40.630.30.22.1
3.40.630.30.22.1.1
3.40.630.30.22.1.1.1
3.40.630.30.22.1.1.1.1

[top]
Segment boundaries for domain 2ozhA01

Chopping figure for domain 2ozhA01
DomainStart PDB ResidueStop PDB Residue
2ozhA01 0 132

Structural Neighbourhood (24 entries)

There are 24 matching structural neighberhood comparisons for CATH ID 3.40.630.30.22.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 24 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1y7rA00 85.48 Staphylococcus aureus subsp. aureus Mu50Putative uncharacterized protein 3.40.630.30 125 18 88 2.48 2.79
2atrA00 85.22 Acetyltransferase, GNAT familyStreptococcus pneumoniae 3.40.630.30 127 15 87 2.68 3.07
2pdoA01 84.21 Shigella flexneriAcetyltransferase ypeA 3.40.630.30 118 16 85 2.74 3.19
1sqhA02 82.65 Drosophila melanogasterCG14615 3.40.630.30 128 13 80 2.79 3.47
3e0kA00 81.87 Arginine and proline metabolismVibrio parahaemolyticusAmino-acid N-acetyltransferase [EC:2.3.1.1]Amino-acid acetyltransferaseMetabolic pathways 3.40.630.30 143 11 78 2.77 3.54
1s3zA00 81.52 Salmonella enterica subsp. enterica serovar EnteritidisAminoglycoside 6'-N-acetyltransferase 3.40.630.30 147 20 78 3.11 3.98
2ozgA01 81.14 Anabaena variabilis ATCC 29413GCN5-related N-acetyltransferase 3.40.630.30 117 9 85 3.88 4.52
3k9uA00 80.01 Putative uncharacterized protein Ta0374Thermoplasma acidophilum 3.40.630.30 159 18 72 3.51 4.85
2fiwA00 79.82 Putative acetyltransferase [EC:2.3.1.-]GCN5-related N-acetyltransferase:Aminotransferase, class-IIRhodopseudomonas palustris 3.40.630.30 156 14 73 3.65 4.99
1q2yA00 79.77 Bacillus subtilisUncharacterized N-acetyltransferase yjcF 3.40.630.30 140 13 81 3.97 4.88
1qsmD00 79.71 CytoplasmIdentical protein bindingSaccharomyces cerevisiaeHistone acetyltransferase activityHistone acetyltransferase HPA2 3.40.630.30 152 12 76 3.71 4.82
2ae6A00 79.42 Acetyltransferase, GNAT familyEnterococcus faecalis 3.40.630.30 144 14 78 3.50 4.46
2q0yA01 79.29 Ralstonia eutropha JMP134GCN5-related N-acetyltransferase 3.40.630.30 125 12 80 3.17 3.92
2q7bA00 79.22 Acetyltransferase, GNAT familyStreptococcus agalactiae serogroup V 3.40.630.30 161 11 73 3.17 4.29
3d8pB00 78.89 Staphylococcus aureus subsp. aureus Mu50Putative uncharacterized protein 3.40.630.30 157 12 72 3.09 4.26
3dsbA01 78.84 Putative acetyltransferaseClostridium difficile 630 3.40.630.30 96 11 68 3.34 4.89
2hv2A01 78.81 Enterococcus faecalisPutative uncharacterized protein 3.40.630.30 90 14 66 2.94 4.41
2r1iA01 78.45 Arthrobacter sp. FB24GCN5-related N-acetyltransferase 3.40.630.30 129 9 81 3.33 4.09
2fe7A00 78.43 Pseudomonas aeruginosaProbable N-acetyltransferase 3.40.630.30 154 12 72 3.08 4.24
2ge3B00 78.38 Agrobacterium tumefaciens str. C58Probable acetyltransferase 3.40.630.30 159 20 72 3.39 4.69
1n71B00 78.04 Aac(6')-Ii proteinEnterococcus faecium 3.40.630.30 179 13 64 3.08 4.75
2fiaA00 77.49 Acetyltransferase, GNAT familyEnterococcus faecalis 3.40.630.30 157 12 71 3.13 4.35
1bobA02 77.37 Chromatin silencing at telomereHistone acetyltransferase 1 [EC:2.3.1.48]Histone acetyltransferase type B catalytic subunitHistone acetyltransferase activityProtein binding 3.40.630.30 124 8 73 3.49 4.76
2hqyA02 72.82 Hypothetical proteinBacteroides thetaiotaomicronPutative uncharacterized protein 3.40.630.30 164 9 68 3.37 4.89
[1]
Displaying entries 1 to 24 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2ozhA01
GPHVHVSTDNSLLDIGLIHRTLSQDTDWAKDIPLALVQRAIDHSLCFGGFVDGRQVAFARVISDYATFAYLGDVFVLPEH
RGRGYSKALDAVAHPDLQGLRRFSLATSDAHGLYARYGFTPPLFPQSLE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2ozhA01
GXPHVHVSTDNSLLDIGLIHRTLSQDTDWAKDIPLALVQRAIDHSLCFGGFVDGRQVAFARVISDYATFAYLGDVFVLPE
HRGRGYSKALXDAVXAHPDLQGLRRFSLATSDAHGLYARYGFTPPLFPQSLXE
BLAST against CATH

[top]
Domain History Events (59)

Domain assigned by cuff on 02 Apr 2008 12:16

same superfamily

Domain assignment manual match h by cuff on 02 Apr 2008 12:15

great scores

Domain assignment manual match t by tronnberg on 17 Sep 2007 15:33

SSAP: 82.7 OV: 80 SEQ: 13. Similar linkage and structure. The query's function is unknown.

Homcheck review by tronnberg on 17 Sep 2007 15:33

SSAP: 82.7 OV: 80 SEQ: 13. Similar linkage and structure. The query's function is unknown.

Flow stage update by tronnberg on 17 Sep 2007 15:33

SSAP: 82.7 OV: 80 SEQ: 13. Similar linkage and structure. The query's function is unknown.

Homcheck allotment by tronnberg on 17 Sep 2007 15:31

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 17 Sep 2007 15:31

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 15 Sep 2007 19:06

Domain "2ozhA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 15 Sep 2007 19:05

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2ozhA01

Flow stage update by auto on 15 Sep 2007 15:13

Retrieved PRC_PFAMCATH results for job ID SID2033812644692980 and results inserted.

Domain scan prc pfamcath by auto on 15 Sep 2007 15:12

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 276 results for 2ozhA01

Update comment by auto on 15 Sep 2007 09:15

PRC_PFAMCATH job SID2033812644692980 is not yet finished.

Prc pfamcath submit by auto on 15 Sep 2007 08:38

The entry "2ozhA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Sep 2007 08:38

The entry "2ozhA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 14 Sep 2007 22:58

Retrieved SSAP results for job ID SID2902944585593780 and results inserted.

Domain scan ssap cath by auto on 14 Sep 2007 22:56

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1110 results for 2ozhA01

Update comment by auto on 09 Sep 2007 23:08

SSAP job SID2902944585593780 is not yet finished.

Ssap cath submit by auto on 09 Sep 2007 22:26

The entry "2ozhA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 22:26

The entry "2ozhA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 19:58

Giving up on SSAP job SID6582027739538072 because submission time of Wed Sep 5 16:20:16 2007 is more than 345600 seconds older than current time (Sun Sep 9 19:59:00 2007).

Update comment by auto on 05 Sep 2007 19:43

SSAP job SID6582027739538072 is not yet finished.

Flow stage update by auto on 05 Sep 2007 16:20

The entry "2ozhA01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 05 Sep 2007 16:20

The entry "2ozhA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 10:28

Retrieved PRC results for job ID SID1337623837248160 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 10:27

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 64 results for 2ozhA01

Flow stage update by auto on 05 Sep 2007 03:55

The entry "2ozhA01" has been submitted to the PRC webservice.

Prc cath submit by auto on 05 Sep 2007 03:55

The entry "2ozhA01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 23:13

Retrieved HMM(SAM) results for job ID SID4948289156961792 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 23:12

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 46 results for 2ozhA01

Update comment by auto on 04 Sep 2007 12:15

HMM(SAM) job SID4948289156961792 is not yet finished.

Flow stage update by auto on 04 Sep 2007 10:07

The entry "2ozhA01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 04 Sep 2007 10:07

The entry "2ozhA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 03:18

Retrieved "2ozhA01" CATHEDRAL results for job ID SID6529215144816816 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 03:17

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 33 results for 2ozhA01

Cathedral cath submit by auto on 03 Sep 2007 14:11

The entry "2ozhA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 14:11

The entry "2ozhA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:13

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2ozhA01.scanlist" for "2ozhA01"

Write scan list by auto on 03 Sep 2007 12:13

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2ozhA01.scanlist" for domain "2ozhA01"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:31

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:36

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:32

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:21

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:22

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:15

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:28

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:12

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:14

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:16

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:41

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:15

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:32

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:06

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 31 Aug 2007 20:01

No satisfactory AssignClose result found.

Flow stage update by auto on 31 Aug 2007 19:48

No in_process hits for Domain "2ozhA01" ready to be processed

Flow stage update by auto on 31 Aug 2007 19:48

NW result present for Domain "2ozhA01"

Flow stage update by auto on 24 Aug 2007 10:06

All required files are present for Domain "2ozhA01"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2ozhA01"

Insertion by cuff on 23 Aug 2007 12:19

nice chopping