CATH Domain: 2oyoA02 XML data for domain: 2oyoA02

Molscript image for 2oyoA02
2oyoA02
PDB coordinates for domain 2oyoA02

PDB 2oyo, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1290 AhpD-like
1.20.1290.10 AhpD-like Gene3D
1.20.1290.10.2
1.20.1290.10.2.1
1.20.1290.10.2.1.1
1.20.1290.10.2.1.1.1
1.20.1290.10.2.1.1.1.1

[top]
Segment boundaries for domain 2oyoA02

Chopping figure for domain 2oyoA02
DomainStart PDB ResidueStop PDB Residue
2oyoA01 19 70
2oyoA02 71 195

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 1.20.1290.10.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1gu9C00 79.35 Alkyl hydroperoxide reductase subunit DAlkyl hydroperoxide reductase AhpDMycobacterium tuberculosis 1.20.1290.10 166 13 64 3.03 4.70
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2oyoA02
YLTNAERELVAVVVSGVNRCLYCAVSHGAALREFLGDPQKADAVAVNWRHADLTEREQALAAYAEKLTRHPAEVTAADLE
PLRAVGLDDHQIELVQVIGFNLTNRVSSALGFVPNPEYYRQAR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2oyoA02
YLTNAERELVAVVVSGVNRCLYCAVSHGAALREFLGDPQKADAVAVNWRHADLTEREQALAAYAEKLTRHPAEVTAADLE
PLRAVGLDDHQIXELVQVIGXFNLTNRVSSALGFVPNPEYYRQAR
BLAST against CATH

[top]
Domain History Events (59)

Domain assigned by cuff on 28 Apr 2008 17:26

same superfamily

Domain assignment manual match h by cuff on 28 Apr 2008 17:23

ample evidence for homology. same superfamily in scop

Domain assignment manual match t by tronnberg on 17 Sep 2007 14:32

SSAP: 79.3 OV: 64 SEQ: 13. Reasonable similar structure (some differences in the structure involving 2 alfa helices). Similar linkage. None of the matches on the Scan List (with a assigned CATH code and a SSAP score of 70 or above) has the same fucntion as the query.

Homcheck review by tronnberg on 17 Sep 2007 14:32

SSAP: 79.3 OV: 64 SEQ: 13. Reasonable similar structure (some differences in the structure involving 2 alfa helices). Similar linkage. None of the matches on the Scan List (with a assigned CATH code and a SSAP score of 70 or above) has the same fucntion as the query.

Flow stage update by tronnberg on 17 Sep 2007 14:32

SSAP: 79.3 OV: 64 SEQ: 13. Reasonable similar structure (some differences in the structure involving 2 alfa helices). Similar linkage. None of the matches on the Scan List (with a assigned CATH code and a SSAP score of 70 or above) has the same fucntion as the query.

Homcheck allotment by tronnberg on 17 Sep 2007 14:25

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 17 Sep 2007 14:25

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 15 Sep 2007 19:00

Domain "2oyoA02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 15 Sep 2007 18:59

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2oyoA02

Flow stage update by auto on 15 Sep 2007 15:07

Retrieved PRC_PFAMCATH results for job ID SID0242878051217388 and results inserted.

Domain scan prc pfamcath by auto on 15 Sep 2007 15:06

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 12 results for 2oyoA02

Update comment by auto on 15 Sep 2007 09:15

PRC_PFAMCATH job SID0242878051217388 is not yet finished.

Prc pfamcath submit by auto on 15 Sep 2007 08:37

The entry "2oyoA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Sep 2007 08:37

The entry "2oyoA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 14 Sep 2007 22:51

Retrieved SSAP results for job ID SID8445825948560176 and results inserted.

Domain scan ssap cath by auto on 14 Sep 2007 22:49

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2165 results for 2oyoA02

Update comment by auto on 09 Sep 2007 23:08

SSAP job SID8445825948560176 is not yet finished.

Ssap cath submit by auto on 09 Sep 2007 22:25

The entry "2oyoA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 22:25

The entry "2oyoA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 19:58

Giving up on SSAP job SID5124337180256544 because submission time of Wed Sep 5 16:19:34 2007 is more than 345600 seconds older than current time (Sun Sep 9 19:58:32 2007).

Update comment by auto on 05 Sep 2007 19:42

SSAP job SID5124337180256544 is not yet finished.

Ssap cath submit by auto on 05 Sep 2007 16:19

The entry "2oyoA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 16:19

The entry "2oyoA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 10:23

Retrieved PRC results for job ID SID8959165280210464 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 10:22

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 8 results for 2oyoA02

Flow stage update by auto on 05 Sep 2007 03:54

The entry "2oyoA02" has been submitted to the PRC webservice.

Prc cath submit by auto on 05 Sep 2007 03:54

The entry "2oyoA02" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 23:09

Retrieved HMM(SAM) results for job ID SID2121055580740288 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 23:08

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 3 results for 2oyoA02

Update comment by auto on 04 Sep 2007 12:14

HMM(SAM) job SID2121055580740288 is not yet finished.

Sam cath submit by auto on 04 Sep 2007 10:07

The entry "2oyoA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 10:07

The entry "2oyoA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 03:13

Retrieved "2oyoA02" CATHEDRAL results for job ID SID6142729868448384 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 03:12

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 87 results for 2oyoA02

Cathedral cath submit by auto on 03 Sep 2007 14:11

The entry "2oyoA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 14:11

The entry "2oyoA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:13

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2oyoA02.scanlist" for "2oyoA02"

Write scan list by auto on 03 Sep 2007 12:13

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2oyoA02.scanlist" for domain "2oyoA02"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:31

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:36

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:32

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:21

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:22

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:15

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:28

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:12

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:14

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:16

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:41

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:15

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:32

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:06

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 31 Aug 2007 20:01

No satisfactory AssignClose result found.

Flow stage update by auto on 31 Aug 2007 19:48

No in_process hits for Domain "2oyoA02" ready to be processed

Flow stage update by auto on 31 Aug 2007 19:48

NW result present for Domain "2oyoA02"

Flow stage update by auto on 24 Aug 2007 10:06

All required files are present for Domain "2oyoA02"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2oyoA02"

Insertion by cuff on 23 Aug 2007 12:58

nice chopping