CATH Domain: 2oyoA01 XML data for domain: 2oyoA01

Molscript image for 2oyoA01
2oyoA01
PDB coordinates for domain 2oyoA01

PDB 2oyo, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.5 Single alpha-helices involved in coiled-coils or other helix-helix interfaces
1.20.5.810 AhpD-like Gene3D
1.20.5.810.1
1.20.5.810.1.1
1.20.5.810.1.1.1
1.20.5.810.1.1.1.1
1.20.5.810.1.1.1.1.1

Segment boundaries for domain 2oyoA01

Chopping figure for domain 2oyoA01
DomainStart PDB ResidueStop PDB Residue
2oyoA01 19 70
2oyoA02 71 195

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 1.20.5.810.1.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2prrA01 90.79 Ralstonia eutropha JMP134Alkylhydroperoxidase AhpD core:Uncharacterised peroxidase-related 1.20.5.810 52 30 98 1.43 1.46
2pfxA01 87.20 Uncharacterised peroxidase-relatedRuegeria sp. TM1040 1.20.5.810 47 31 90 2.20 2.43
Displaying entries 1 to 2 (page 1 of 1)


Domain ATOM Sequence

>pdb|2oyoA01
DATQVPEGVRKLWAKAEANIGFVPNVFRAQAVNGEQFLAWWNYFNLLLNKEG    

Domain COMBS Sequence

>pdb|2oyoA01
DATQVPEGVRKLWAKAEANIGFVPNVFRAQAVNGEQFLAWWNYFNLLLNKEG    

Domain History Events (59)

Domain assigned by cuff on 13 May 2008 12:23

same superfamily

Domain assignment manual match h by cuff on 13 May 2008 12:20

same family in scop, excellent structural comparison, nice scores

Domain assignment manual match t by tronnberg on 17 Sep 2007 14:24

SSAP: 79.8 OV: 90 SEQ: 9. Similar linkage and reasonable similar structure. Functionally different. None of the matches on the Scan List (with an assigned CATH code and a SSAP score of 70 or above) has the same function as the query. I think that 2pfxB01 (TBA) should be assigned to the same topologuy as the query (and perhaps also the same H- family).

Homcheck review by tronnberg on 17 Sep 2007 14:24

SSAP: 79.8 OV: 90 SEQ: 9. Similar linkage and reasonable similar structure. Functionally different. None of the matches on the Scan List (with an assigned CATH code and a SSAP score of 70 or above) has the same function as the query. I think that 2pfxB01 (TBA) should be assigned to the same topologuy as the query (and perhaps also the same H- family).

Flow stage update by tronnberg on 17 Sep 2007 14:24

SSAP: 79.8 OV: 90 SEQ: 9. Similar linkage and reasonable similar structure. Functionally different. None of the matches on the Scan List (with an assigned CATH code and a SSAP score of 70 or above) has the same function as the query. I think that 2pfxB01 (TBA) should be assigned to the same topologuy as the query (and perhaps also the same H- family).

Homcheck allotment by tronnberg on 17 Sep 2007 14:14

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 17 Sep 2007 14:14

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 15 Sep 2007 19:02

Domain "2oyoA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 15 Sep 2007 19:01

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2oyoA01

Flow stage update by auto on 15 Sep 2007 15:09

Retrieved PRC_PFAMCATH results for job ID SID1199985627126037 and results inserted.

Domain scan prc pfamcath by auto on 15 Sep 2007 15:08

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2oyoA01

Update comment by auto on 15 Sep 2007 09:15

PRC_PFAMCATH job SID1199985627126037 is not yet finished.

Prc pfamcath submit by auto on 15 Sep 2007 08:37

The entry "2oyoA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Sep 2007 08:37

The entry "2oyoA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 12 Sep 2007 10:38

Retrieved SSAP results for job ID SID9846321185189472 and results inserted.

Domain scan ssap cath by auto on 12 Sep 2007 10:36

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2237 results for 2oyoA01

Update comment by auto on 09 Sep 2007 23:08

SSAP job SID9846321185189472 is not yet finished.

Ssap cath submit by auto on 09 Sep 2007 22:25

The entry "2oyoA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 22:25

The entry "2oyoA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 19:58

Giving up on SSAP job SID4111404173106528 because submission time of Wed Sep 5 16:19:25 2007 is more than 345600 seconds older than current time (Sun Sep 9 19:58:24 2007).

Update comment by auto on 05 Sep 2007 19:42

SSAP job SID4111404173106528 is not yet finished.

Ssap cath submit by auto on 05 Sep 2007 16:19

The entry "2oyoA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 16:19

The entry "2oyoA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 10:21

Retrieved PRC results for job ID SID4936754550236624 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 10:20

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 6 results for 2oyoA01

Prc cath submit by auto on 05 Sep 2007 03:54

The entry "2oyoA01" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 03:54

The entry "2oyoA01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 23:08

Retrieved HMM(SAM) results for job ID SID9910631981050368 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 23:07

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 4 results for 2oyoA01

Update comment by auto on 04 Sep 2007 12:14

HMM(SAM) job SID9910631981050368 is not yet finished.

Sam cath submit by auto on 04 Sep 2007 10:07

The entry "2oyoA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 10:07

The entry "2oyoA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 03:12

Retrieved "2oyoA01" CATHEDRAL results for job ID SID3779754736911488 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 03:11

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 117 results for 2oyoA01

Cathedral cath submit by auto on 03 Sep 2007 14:10

The entry "2oyoA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 14:10

The entry "2oyoA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:13

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2oyoA01.scanlist" for "2oyoA01"

Write scan list by auto on 03 Sep 2007 12:12

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2oyoA01.scanlist" for domain "2oyoA01"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:31

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:36

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:32

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:21

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:22

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:15

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:28

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:12

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:14

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:16

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:41

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:15

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:32

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:06

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 31 Aug 2007 20:01

No satisfactory AssignClose result found.

Flow stage update by auto on 31 Aug 2007 19:48

No in_process hits for Domain "2oyoA01" ready to be processed

Flow stage update by auto on 31 Aug 2007 19:48

NW result present for Domain "2oyoA01"

Flow stage update by auto on 24 Aug 2007 10:06

All required files are present for Domain "2oyoA01"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2oyoA01"

Insertion by cuff on 23 Aug 2007 12:58

nice chopping