CATH Domain: 2ovlA01

2ovlA01

PDB 2ovl, Chain A, Domain 1

CATH Code	Level Description	Links
3	Alpha Beta
3.30	2-Layer Sandwich
3.30.390	Enolase-like; domain 1
3.30.390.10	Enolase-like, N-terminal domain	Gene3D
3.30.390.10.21
3.30.390.10.21.1
3.30.390.10.21.1.1
3.30.390.10.21.1.1.1
3.30.390.10.21.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 2ovlA01

Domain	Start PDB Residue	Stop PDB Residue
2ovlA01	3	120
2ovlA01	354	362
2ovlA02	121	353

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (11 entries)

There are 11 matching structural neighberhood comparisons for CATH ID 3.30.390.10.21.1.1.1.1 (SIMAX score < 5)

Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
1nu5A01	89.17	Chloromuconate cycloisomerasePseudomonas sp. P51	3.30.390.10	116	23	86	2.04	2.37
3bjsA01	88.59	Polaromonas sp. JS666Mandelate racemase/muconate lactonizing enzyme	3.30.390.10	116	25	90	1.88	2.08
1tkkA01	88.05	Bacillus subtilisL-Ala-D/L-Glu epimerase	3.30.390.10	115	23	86	1.96	2.25
2qq6B01	87.79	Rubrobacter xylanophilus DSM 9941Mandelate racemase/muconate lactonizing enzyme-like protein	3.30.390.10	115	23	84	1.76	2.08
2oqyA01	86.22	Muconate cycloisomeraseOceanobacillus iheyensis	3.30.390.10	142	18	78	2.52	3.19
2pgwA01	84.12	Sinorhizobium melilotiToluene and xylene degradationBenzoate degradation via hydroxylationMuconate cycloisomerase [EC:5.5.1.1]Mandelate racemase/muconate lactonizing enzyme family protein	3.30.390.10	147	20	81	2.31	2.83
2hzgB01	84.04	Rhodobacter sphaeroides 2.4.1Mandelate racemase/muconate lactonizing enzyme/Enolase superfamily	3.30.390.10	143	20	78	2.80	3.58
1jpdX01	83.83	Racemase and epimerase activity, acting on amino acids and derivativesL-Ala-D/L-Glu epimeraseEscherichia coli K-12	3.30.390.10	99	23	77	2.56	3.31
2oz8A01	83.46	Mesorhizobium lotiMll7089 protein	3.30.390.10	128	17	89	3.26	3.66
2nqlA01	83.10	Agrobacterium tumefaciens str. C58Isomerase/lactonizing enzyme	3.30.390.10	162	26	74	3.31	4.43
1stzA03	74.35	Thermotoga maritimaHeat-inducible transcription repressor hrcAHeat-inducible transcriptional repressor	3.30.390.60	89	10	68	3.21	4.70

[top]
Domain ATOM Sequence

>pdb|2ovlA01
LIERVRTDLYRIPLPTRLTDSTHGADFELITVRIEDSDGATGLGYTYTVNHGGAAVATVDKDLRGCLLGADAEQIEKIWQ
SWWRLHYAGRGGHATSAISAVDIALWDLKGIRARFERLGRLAV

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|2ovlA01
XSLIERVRTDLYRIPLPTRLTDSTHGAXXDFELITVRIEDSDGATGLGYTYTVNHGGAAVATXVDKDLRGCLLGADAEQI
EKIWQSXWWRLHYAGRGGHATSAISAVDIALWDLKGIRARFERLGRLAVGEGHHHHHH

BLAST against CATH

[top]
Domain History Events (16)

Domain assigned by auto on 14 Feb 2008 18:13

Assigning to "3.30.390.10" based on similarity with "2ovlD01"

Flow stage update by auto on 14 Feb 2008 18:11

No in_process hits for Domain "2ovlA01" ready to be processed

Update comment by auto on 14 Feb 2008 17:57

Domain "2ovlA01" hits Domain "2ovlB01" (96.3768115942029% over 100%) which is currently in process

Update comment by auto on 14 Feb 2008 17:43

Domain "2ovlA01" hits Domain "2ovlD01" (96.3768115942029% over 100%) which is currently in process

Update comment by auto on 14 Feb 2008 17:27

Domain "2ovlA01" hits Domain "2ovlC01" (96.3768115942029% over 100%) which is currently in process

Update comment by auto on 14 Feb 2008 17:10

Domain "2ovlA01" hits Domain "2og9A01" (35.5072463768116% over 85.625%) which is currently in process