Domain assigned by cuff on 02 Apr 2008 14:35
same superfamily
| CATH Code | Level Description | Links |
|---|---|---|
3
| Alpha Beta | |
3.10
| Roll | |
3.10.129
| Thiol Ester Dehydrase; Chain A | |
3.10.129.10
| Gene3D | |
3.10.129.10.18
| ||
3.10.129.10.18.1
| ||
3.10.129.10.18.1.1
| ||
3.10.129.10.18.1.1.2
| ||
3.10.129.10.18.1.1.2.1
|
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2ov9D01 | 15 | 21 |
| 2ov9D01 | 81 | 208 |
| 2ov9D02 | 22 | 80 |
There are 16 matching structural neighberhood comparisons for CATH ID 3.10.129.10.18.1.1.2.1 (SIMAX score < 5)
>pdb|2ov9D01 GTVLTSPNGEGVTRHDPVTGPENALAPPVVLEGLSDGSVRGTVTLTIPYQGPPGHVHGGVSALLLDHVLGVANAWGGKAG TAQLSTRYHRPTPLFEPLTLTGKLSVDGRKITTAGDIRTADGQVCVSVEGLFV
same superfamily
great scores
SSAP: 83.3 OV: 92 SEQ: 13. Simialr linkage and structure. Similar function. The match is a 4-hydroxybenzoyl coa thioesterase and the query is a rha08564, thioesterase superfamily protein.
SSAP: 83.3 OV: 92 SEQ: 13. Simialr linkage and structure. Similar function. The match is a 4-hydroxybenzoyl coa thioesterase and the query is a rha08564, thioesterase superfamily protein.
SSAP: 83.3 OV: 92 SEQ: 13. Simialr linkage and structure. Similar function. The match is a 4-hydroxybenzoyl coa thioesterase and the query is a rha08564, thioesterase superfamily protein.
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Domain "2ov9D01" SCOP scan with no results - no SCOP mapping
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2ov9D01
Retrieved PRC_PFAMCATH results for job ID SID1005638200324220 and results inserted.
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 83 results for 2ov9D01
PRC_PFAMCATH job SID1005638200324220 is not yet finished.
The entry "2ov9D01" has been submitted to the PRC_PFAMCATH webservice.
The entry "2ov9D01" has been submitted to the PRC_PFAMCATH webservice.
Retrieved SSAP results for job ID SID0957744177718576 and results inserted.
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2368 results for 2ov9D01
SSAP job SID0957744177718576 is not yet finished.
The entry "2ov9D01" has been submitted to the SSAP webservice.
The entry "2ov9D01" has been submitted to the SSAP webservice.
Giving up on SSAP job SID5107345096032944 because submission time of Wed Sep 5 16:17:09 2007 is more than 345600 seconds older than current time (Sun Sep 9 19:57:08 2007).
SSAP job SID5107345096032944 is not yet finished.
The entry "2ov9D01" has been submitted to the SSAP webservice.
The entry "2ov9D01" has been submitted to the SSAP webservice.
Retrieved PRC results for job ID SID9501409220027328 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 40 results for 2ov9D01
The entry "2ov9D01" has been submitted to the PRC webservice.
The entry "2ov9D01" has been submitted to the PRC webservice.
Retrieved HMM(SAM) results for job ID SID9461846169621760 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 12 results for 2ov9D01
HMM(SAM) job SID9461846169621760 is not yet finished.
The entry "2ov9D01" has been submitted to the HMM (SAM) webservice.
The entry "2ov9D01" has been submitted to the HMM (SAM) webservice.
Retrieved "2ov9D01" CATHEDRAL results for job ID SID0854433079043488 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 19 results for 2ov9D01
The entry "2ov9D01" has been submitted to the CATHEDRAL webservice.
The entry "2ov9D01" has been submitted to the CATHEDRAL webservice.
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2ov9D01.scanlist" for "2ov9D01"
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2ov9D01.scanlist" for domain "2ov9D01"
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
No satisfactory AssignClose result found.
No in_process hits for Domain "2ov9D01" ready to be processed
NW result present for Domain "2ov9D01"
All required files are present for Domain "2ov9D01"
Beginning processing for Domain "2ov9D01"
nice chopping