CATH Domain: 2ov9D01 XML data for domain: 2ov9D01

Molscript image for 2ov9D01
2ov9D01
PDB coordinates for domain 2ov9D01

PDB 2ov9, Chain D, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.129 Thiol Ester Dehydrase; Chain A
3.10.129.10 Gene3D
3.10.129.10.18
3.10.129.10.18.1
3.10.129.10.18.1.1
3.10.129.10.18.1.1.2
3.10.129.10.18.1.1.2.1

Segment boundaries for domain 2ov9D01

Chopping figure for domain 2ov9D01
DomainStart PDB ResidueStop PDB Residue
2ov9D01 15 21
2ov9D01 81 208
2ov9D02 22 80

Structural Neighbourhood (16 entries)

There are 16 matching structural neighberhood comparisons for CATH ID 3.10.129.10.18.1.1.2.1 (SIMAX score < 5)

Displaying entries 1 to 16 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2pimA00 83.85 Ralstonia eutropha JMP134Phenylacetic acid degradation-related protein 3.10.129.10 127 17 80 2.49 3.07
2fs2B00 83.78 Acyl-coenzyme A thioesterase paaIPhenylacetic acid degradation proteinEscherichia coli K-12 3.10.129.10 134 15 88 2.78 3.13
2prxA00 83.66 Shewanella loihica PV-4Thioesterase superfamily protein 3.10.129.10 108 22 74 2.27 3.04
1ixlA00 82.87 Putative uncharacterized protein PH1136Pyrococcus horikoshii 3.10.129.10 127 14 83 3.13 3.73
1zkiA00 82.62 Pseudomonas aeruginosaPhenylacetic acid degradation proteinPutative uncharacterized protein 3.10.129.10 118 14 78 2.53 3.21
2q2bA00 82.46 Mus musculusCytosolic acyl coenzyme A thioester hydrolaseFatty acid catabolic processPalmitoyl-CoA hydrolase activity 3.10.129.10 141 14 69 2.74 3.93
2qwzA01 82.10 Phenylacetic acid degradation-related proteinRuegeria sp. TM1040 3.10.129.10 128 12 85 3.05 3.58
1c8uA02 82.07 Biosynthesis of unsaturated fatty acidsAcyl-CoA thioesterase II [EC:3.1.2.-]Acyl-CoA thioesterase 2Acyl-CoA thioesterase activityFatty acid catabolic process 3.10.129.10 115 7 74 3.20 4.29
3b7kA02 81.94 Acetyl-CoA hydrolase [EC:3.1.2.1]Pyruvate metabolismHomo sapiensAcyl-coenzyme A thioesterase 12 3.10.129.10 121 9 71 3.31 4.65
3b7kC02 81.82 Acetyl-CoA hydrolase [EC:3.1.2.1]Pyruvate metabolismHomo sapiensAcyl-coenzyme A thioesterase 12 3.10.129.10 110 10 69 1.92 2.78
1z6bC00 81.49 Fatty acid biosynthesisMetabolic pathways3R-hydroxymyristoyl ACP dehydrase [EC:4.2.1.-]Plasmodium falciparumBeta-hydroxyacyl-ACP dehydratase 3.10.129.10 138 10 88 3.96 4.50
1tbuB00 81.48 Palmitoyl-CoA hydrolase [EC:3.1.2.2]Protein bindingBiosynthesis of unsaturated fatty acidsPeroxisomal acyl-coenzyme A thioester hydrolase 1Peroxisome 3.10.129.10 98 8 66 2.77 4.14
1njkA00 81.06 Long-chain acyl-CoA thioesterase tesCAcyl-CoA thioesterase activityThioesterase III [EC:3.1.2.-]Fatty acid beta-oxidationEscherichia coli K-12 3.10.129.10 130 13 67 2.40 3.55
2oiwA00 80.52 Geobacillus kaustophilusHypothetical conserved protein 3.10.129.10 129 7 64 2.01 3.10
2hljA01 78.74 Pseudomonas putida KT2440Putative uncharacterized protein 3.10.129.10 132 10 69 2.65 3.80
3b7kB01 75.68 Acetyl-CoA hydrolase [EC:3.1.2.1]Pyruvate metabolismHomo sapiensAcyl-coenzyme A thioesterase 12 3.10.129.10 140 7 67 3.33 4.93
Displaying entries 1 to 16 (page 1 of 1)


Domain ATOM Sequence

>pdb|2ov9D01
GTVLTSPNGEGVTRHDPVTGPENALAPPVVLEGLSDGSVRGTVTLTIPYQGPPGHVHGGVSALLLDHVLGVANAWGGKAG
TAQLSTRYHRPTPLFEPLTLTGKLSVDGRKITTAGDIRTADGQVCVSVEGLFV    

Domain COMBS Sequence

>pdb|2ov9D01
VSVGTHPTFENSPSGTVLTSPNGEGVTRHDPVTGPENALAPPVVLEGLSDGSVRGTVTLTIPYQGPPGHVHGGVSALLLD
HVLGVANAWGGKAGXTAQLSTRYHRPTPLFEPLTLTGKLXSVDGRKITTAGDIRTADGQVCVSVEGLFVDKTVPRPR    

Domain History Events (59)

Domain assigned by cuff on 02 Apr 2008 14:35

same superfamily

Domain assignment manual match h by cuff on 02 Apr 2008 14:33

great scores

Domain assignment manual match t by tronnberg on 17 Sep 2007 12:32

SSAP: 83.3 OV: 92 SEQ: 13. Simialr linkage and structure. Similar function. The match is a 4-hydroxybenzoyl coa thioesterase and the query is a rha08564, thioesterase superfamily protein.

Homcheck review by tronnberg on 17 Sep 2007 12:32

SSAP: 83.3 OV: 92 SEQ: 13. Simialr linkage and structure. Similar function. The match is a 4-hydroxybenzoyl coa thioesterase and the query is a rha08564, thioesterase superfamily protein.

Flow stage update by tronnberg on 17 Sep 2007 12:32

SSAP: 83.3 OV: 92 SEQ: 13. Simialr linkage and structure. Similar function. The match is a 4-hydroxybenzoyl coa thioesterase and the query is a rha08564, thioesterase superfamily protein.

Homcheck allotment by tronnberg on 17 Sep 2007 12:26

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 17 Sep 2007 12:26

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 15 Sep 2007 18:50

Domain "2ov9D01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 15 Sep 2007 18:49

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2ov9D01

Flow stage update by auto on 15 Sep 2007 14:57

Retrieved PRC_PFAMCATH results for job ID SID1005638200324220 and results inserted.

Domain scan prc pfamcath by auto on 15 Sep 2007 14:56

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 83 results for 2ov9D01

Update comment by auto on 15 Sep 2007 09:13

PRC_PFAMCATH job SID1005638200324220 is not yet finished.

Flow stage update by auto on 15 Sep 2007 08:36

The entry "2ov9D01" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 15 Sep 2007 08:36

The entry "2ov9D01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 12 Sep 2007 10:28

Retrieved SSAP results for job ID SID0957744177718576 and results inserted.

Domain scan ssap cath by auto on 12 Sep 2007 10:26

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2368 results for 2ov9D01

Update comment by auto on 09 Sep 2007 23:07

SSAP job SID0957744177718576 is not yet finished.

Ssap cath submit by auto on 09 Sep 2007 22:24

The entry "2ov9D01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 22:24

The entry "2ov9D01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 19:57

Giving up on SSAP job SID5107345096032944 because submission time of Wed Sep 5 16:17:09 2007 is more than 345600 seconds older than current time (Sun Sep 9 19:57:08 2007).

Update comment by auto on 05 Sep 2007 19:41

SSAP job SID5107345096032944 is not yet finished.

Flow stage update by auto on 05 Sep 2007 16:17

The entry "2ov9D01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 05 Sep 2007 16:17

The entry "2ov9D01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 10:08

Retrieved PRC results for job ID SID9501409220027328 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 10:07

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 40 results for 2ov9D01

Prc cath submit by auto on 05 Sep 2007 03:52

The entry "2ov9D01" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 03:52

The entry "2ov9D01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 22:57

Retrieved HMM(SAM) results for job ID SID9461846169621760 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 22:56

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 12 results for 2ov9D01

Update comment by auto on 04 Sep 2007 12:13

HMM(SAM) job SID9461846169621760 is not yet finished.

Sam cath submit by auto on 04 Sep 2007 10:05

The entry "2ov9D01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 10:05

The entry "2ov9D01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 02:57

Retrieved "2ov9D01" CATHEDRAL results for job ID SID0854433079043488 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 02:56

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 19 results for 2ov9D01

Flow stage update by auto on 03 Sep 2007 14:09

The entry "2ov9D01" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 03 Sep 2007 14:09

The entry "2ov9D01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:11

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2ov9D01.scanlist" for "2ov9D01"

Write scan list by auto on 03 Sep 2007 12:11

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2ov9D01.scanlist" for domain "2ov9D01"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:31

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:36

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:32

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:21

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:21

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:15

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:27

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:12

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:14

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:16

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:41

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:15

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:32

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:06

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 31 Aug 2007 20:00

No satisfactory AssignClose result found.

Flow stage update by auto on 31 Aug 2007 19:48

No in_process hits for Domain "2ov9D01" ready to be processed

Flow stage update by auto on 31 Aug 2007 19:48

NW result present for Domain "2ov9D01"

Flow stage update by auto on 24 Aug 2007 10:06

All required files are present for Domain "2ov9D01"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2ov9D01"

Insertion by cuff on 23 Aug 2007 12:19

nice chopping