CATH Domain: 2ouwB00 XML data for domain: 2ouwB00

Molscript image for 2ouwB00
2ouwB00
PDB coordinates for domain 2ouwB00

PDB 2ouw, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1290 AhpD-like
1.20.1290.10 AhpD-like Gene3D
1.20.1290.10.5
1.20.1290.10.5.1
1.20.1290.10.5.1.1
1.20.1290.10.5.1.1.1
1.20.1290.10.5.1.1.1.1

[top]
Segment boundaries for domain 2ouwB00

Chopping figure for domain 2ouwB00
DomainStart PDB ResidueStop PDB Residue
2ouwB00 0 135

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2ouwB00
GATVRLLDDAEISTLPEVKAVFDDIRATRGSDFVNNIWRGLANDPALLKRTWEQVKTVVGEGALDPLTREIYLAVSTANS
CSYCAHSHTAAARAKGTPAQHAEVLAIIGLAAQTNALVTAQIPVDEAFLVD
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2ouwB00
GXATVRLLDDAEISTLPEVKAVFDDIRATRGSDFVNNIWRGLANDPALLKRTWEQVKTVXVGEGALDPLTREXIYLAVST
ANSCSYCAHSHTAAARAKGXTPAQHAEVLAIIGLAAQTNALVTAXQIPVDEAFLVDGK
BLAST against CATH

[top]
Domain History Events (59)

Domain assigned by cuff on 04 Apr 2008 16:26

same superfamily

Domain assignment manual match h by cuff on 04 Apr 2008 16:25

ample evidence for homology

Domain assignment manual match t by tronnberg on 17 Sep 2007 12:06

SSAP: 79.1 OV: 81 SEQ: 15. Similar linkage, some structual differences. Functionally different.

Homcheck review by tronnberg on 17 Sep 2007 12:06

SSAP: 79.1 OV: 81 SEQ: 15. Similar linkage, some structual differences. Functionally different.

Flow stage update by tronnberg on 17 Sep 2007 12:06

SSAP: 79.1 OV: 81 SEQ: 15. Similar linkage, some structual differences. Functionally different.

Homcheck allotment by tronnberg on 17 Sep 2007 12:01

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 17 Sep 2007 12:01

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 15 Sep 2007 09:43

Domain "2ouwB00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 15 Sep 2007 09:42

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2ouwB00

Flow stage update by auto on 15 Sep 2007 09:13

Retrieved PRC_PFAMCATH results for job ID SID6464475726220848 and results inserted.

Domain scan prc pfamcath by auto on 15 Sep 2007 09:12

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 12 results for 2ouwB00

Update comment by auto on 12 Sep 2007 07:36

PRC_PFAMCATH job SID6464475726220848 is not yet finished.

Prc pfamcath submit by auto on 12 Sep 2007 07:28

The entry "2ouwB00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 12 Sep 2007 07:28

The entry "2ouwB00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 12 Sep 2007 06:51

Retrieved SSAP results for job ID SID6961533580649576 and results inserted.

Domain scan ssap cath by auto on 12 Sep 2007 06:48

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1433 results for 2ouwB00

Update comment by auto on 09 Sep 2007 23:07

SSAP job SID6961533580649576 is not yet finished.

Flow stage update by auto on 09 Sep 2007 22:24

The entry "2ouwB00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 09 Sep 2007 22:24

The entry "2ouwB00" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 19:57

Giving up on SSAP job SID2981317414019328 because submission time of Wed Sep 5 16:16:55 2007 is more than 345600 seconds older than current time (Sun Sep 9 19:57:02 2007).

Update comment by auto on 05 Sep 2007 19:41

SSAP job SID2981317414019328 is not yet finished.

Flow stage update by auto on 05 Sep 2007 16:16

The entry "2ouwB00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 05 Sep 2007 16:16

The entry "2ouwB00" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 10:06

Retrieved PRC results for job ID SID3560018923027936 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 10:05

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 11 results for 2ouwB00

Prc cath submit by auto on 05 Sep 2007 03:52

The entry "2ouwB00" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 03:52

The entry "2ouwB00" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 22:56

Retrieved HMM(SAM) results for job ID SID4297537482416480 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 22:55

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 5 results for 2ouwB00

Update comment by auto on 04 Sep 2007 12:13

HMM(SAM) job SID4297537482416480 is not yet finished.

Sam cath submit by auto on 04 Sep 2007 10:05

The entry "2ouwB00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 10:05

The entry "2ouwB00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 02:56

Retrieved "2ouwB00" CATHEDRAL results for job ID SID2259010265362287 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 02:54

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 172 results for 2ouwB00

Flow stage update by auto on 03 Sep 2007 14:09

The entry "2ouwB00" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 03 Sep 2007 14:09

The entry "2ouwB00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:11

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2ouwB00.scanlist" for "2ouwB00"

Write scan list by auto on 03 Sep 2007 12:10

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2ouwB00.scanlist" for domain "2ouwB00"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:31

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:36

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:32

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:21

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:21

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:15

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:27

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:12

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:14

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:16

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:41

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:15

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:32

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:06

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 31 Aug 2007 20:00

No satisfactory AssignClose result found.

Flow stage update by auto on 31 Aug 2007 19:48

No in_process hits for Domain "2ouwB00" ready to be processed

Flow stage update by auto on 31 Aug 2007 19:48

NW result present for Domain "2ouwB00"

Flow stage update by auto on 29 Aug 2007 14:34

All required files are present for Domain "2ouwB00"

Flow stage update by auto on 28 Aug 2007 18:20

Beginning processing for Domain "2ouwB00"

Insertion by cuff on 28 Aug 2007 16:32

nice chopping