CATH Domain: 2otdA01 XML data for domain: 2otdA01

Molscript image for 2otdA01
2otdA01
PDB coordinates for domain 2otdA01

PDB 2otd, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.20 Alpha-Beta Barrel
3.20.20 TIM Barrel
3.20.20.190 Phosphatidylinositol (PI) phosphodiesterase Gene3D
3.20.20.190.10
3.20.20.190.10.1
3.20.20.190.10.1.1
3.20.20.190.10.1.1.1
3.20.20.190.10.1.1.1.1

[top]
Segment boundaries for domain 2otdA01

Chopping figure for domain 2otdA01
DomainStart PDB ResidueStop PDB Residue
2otdA01 8 235

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.20.20.190.10.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1vkfA00 75.90 Thermotoga maritimaGlycerol uptake operon antiterminatorGlycerol uptake operon antiterminator-related protein 3.20.20.400 168 11 68 3.13 4.60
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2otdA01
RIVAHRGGGKLAPENTLAAIDVGAKYGHKIEFDAKLSKDGEIFLLHDDNLERTSNGWGVAGELNWQDLLRVDAGSWYSKA
FKGEPLPLLSQVAERCREHGANIEIKPTTGTGPLTGKVALAARQLWAGTPPLLSSFEIDALEAAQQAAPELPRGLLLDEW
RDDWRELTARLGCVSIHLNHKLLDKARVQLKDAGLRILVYTVNKPQHAAELLRWGVDCICTD
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2otdA01
RIVAHRGGGKLAPENTLAAIDVGAKYGHKXIEFDAKLSKDGEIFLLHDDNLERTSNGWGVAGELNWQDLLRVDAGSWYSK
AFKGEPLPLLSQVAERCREHGXXANIEIKPTTGTGPLTGKXVALAARQLWAGXTPPLLSSFEIDALEAAQQAAPELPRGL
LLDEWRDDWRELTARLGCVSIHLNHKLLDKARVXQLKDAGLRILVYTVNKPQHAAELLRWGVDCICTD
BLAST against CATH

[top]
Domain History Events (11)

Domain assigned by auto on 02 Apr 2008 17:20

Assigning to "3.20.20.190" based on similarity with "2otdC01"

Flow stage update by auto on 02 Apr 2008 17:14

No in_process hits for Domain "2otdA01" ready to be processed

Update comment by auto on 02 Apr 2008 17:05

Domain "2otdA01" hits Domain "2otdC01" (97.3684210526316% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 20:10

Domain "2otdA01" hits Domain "2otdD01" (97.3684210526316% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2otdA01" hits Domain "2otdD01" (97.3684210526316% over 100%) which is currently in process

Update comment by auto on 31 Aug 2007 19:49

Domain "2otdA01" hits Domain "2otdD01" (97.3684210526316% over 100%) which is currently in process

Flow stage update by auto on 31 Aug 2007 19:48

Domain "2otdA01" hits Domain "2otdD01" (97.3684210526316% over 100%) which is currently in process

Flow stage update by auto on 31 Aug 2007 19:48

NW result present for Domain "2otdA01"

Flow stage update by auto on 24 Aug 2007 10:06

All required files are present for Domain "2otdA01"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2otdA01"

Insertion by auto on 23 Aug 2007 14:10

Final ChopClose added based on similarity with "2otdD"