CATH Domain: 2or0B01 XML data for domain: 2or0B01

Molscript image for 2or0B01
2or0B01
PDB coordinates for domain 2or0B01

PDB 2or0, Chain B, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.540 Butyryl-Coa Dehydrogenase, subunit A; domain 1
1.10.540.10 Butyryl-Coa Dehydrogenase, subunit A, domain 1 Gene3D
1.10.540.10.7
1.10.540.10.7.1
1.10.540.10.7.1.1
1.10.540.10.7.1.1.1
1.10.540.10.7.1.1.1.1

[top]
Segment boundaries for domain 2or0B01

Chopping figure for domain 2or0B01
DomainStart PDB ResidueStop PDB Residue
2or0B01 -17 106
2or0B02 107 205
2or0B03 206 391

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 1.10.540.10.7.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1r2jA01 78.40 Streptomyces hygroscopicus subsp. ascomyceticusFkbI 1.10.540.10 103 13 80 3.50 4.32
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2or0B01
SHHHHHHSSGRENLYFQGGRVLDRIEVVAEEIRGQAVQSEADCRLTDAAAGLLRDSGAIRLLQPRLYGGYEVHPREFAET
VGVAALDGASGWVTGIVGVHPWELAFADPQVQEEIWGEDNDT
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2or0B01
XGSSHHHHHHSSGRENLYFQGXGRVLDRIEVVAEEIRGQAVQSEADCRLTDAAAGLLRDSGAIRLLQPRLYGGYEVHPRE
FAETVXGVAALDGASGWVTGIVGVHPWELAFADPQVQEEIWGEDNDT
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 21 Feb 2008 16:30

Assigning to "1.10.540.10" based on similarity with "2or0A01"

Flow stage update by auto on 21 Feb 2008 16:16

No in_process hits for Domain "2or0B01" ready to be processed

Update comment by auto on 06 Sep 2007 22:06

Domain "2or0B01" hits Domain "2or0A01" (99.0476190476191% over 82.6771653543307%) which is currently in process

Flow stage update by auto on 06 Sep 2007 22:05

Domain "2or0B01" hits Domain "2or0A01" (99.0476190476191% over 82.6771653543307%) which is currently in process

Flow stage update by auto on 06 Sep 2007 22:05

NW result present for Domain "2or0B01"

Flow stage update by auto on 04 Sep 2007 14:04

All required files are present for Domain "2or0B01"

Flow stage update by auto on 03 Sep 2007 20:09

Beginning processing for Domain "2or0B01"

Insertion by cuff on 03 Sep 2007 14:12

nice chopping