Domain assigned by cuff on 21 Feb 2008 17:53
same superfamily
CATH Domain: 2or0A03
2or0A03
PDB 2or0, Chain A, Domain 3
Segment boundaries for domain 2or0A03
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2or0A01 | 2 | 106 |
| 2or0A02 | 107 | 205 |
| 2or0A03 | 206 | 391 |
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|2or0A03 AAKVDGRAQKEAGRPEPLFNPYSCFPLGITAAVIGITEGALACHIAVQKDRVAITGQKIKEDPYVLSAIGESAAEINASR VSLIETADRFYDKVDAGKEITFEERAIGRRTQIAAAWRAVRAADEIFARAGGGALHYKTPQRFWRDAHAGLAHAVHVPGP TNHASALTQLGGEPQGRAI
Domain History Events (59)
Domain assignment manual match h by cuff on 21 Feb 2008 17:52
excellent scores. homologous
Domain assignment manual match t by tronnberg on 17 Sep 2007 11:18
SSAP: 83.3 OV: 83 SEQ: 11. Similar linkage and structure.Functionally different. None of the matches on the scan list with a SSAP score of 70 or above and with an assigned CATH code has the same function as the query.
Homcheck review by tronnberg on 17 Sep 2007 11:18
SSAP: 83.3 OV: 83 SEQ: 11. Similar linkage and structure.Functionally different. None of the matches on the scan list with a SSAP score of 70 or above and with an assigned CATH code has the same function as the query.
Flow stage update by tronnberg on 17 Sep 2007 11:18
SSAP: 83.3 OV: 83 SEQ: 11. Similar linkage and structure.Functionally different. None of the matches on the scan list with a SSAP score of 70 or above and with an assigned CATH code has the same function as the query.
Homcheck allotment by tronnberg on 17 Sep 2007 11:10
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by tronnberg on 17 Sep 2007 11:10
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 15 Sep 2007 18:45
Domain "2or0A03" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 15 Sep 2007 18:44
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2or0A03
Flow stage update by auto on 15 Sep 2007 14:51
Retrieved PRC_PFAMCATH results for job ID SID3212753460836544 and results inserted.
Domain scan prc pfamcath by auto on 15 Sep 2007 14:51
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 15 results for 2or0A03
Update comment by auto on 15 Sep 2007 09:07
PRC_PFAMCATH job SID3212753460836544 is not yet finished.
Flow stage update by auto on 15 Sep 2007 08:35
The entry "2or0A03" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 15 Sep 2007 08:35
The entry "2or0A03" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 12 Sep 2007 10:20
Retrieved SSAP results for job ID SID5940335682336616 and results inserted.
Domain scan ssap cath by auto on 12 Sep 2007 10:18
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1103 results for 2or0A03
Update comment by auto on 09 Sep 2007 23:06
SSAP job SID5940335682336616 is not yet finished.
Flow stage update by auto on 09 Sep 2007 22:22
The entry "2or0A03" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 09 Sep 2007 22:22
The entry "2or0A03" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 19:55
Giving up on SSAP job SID0011392015429120 because submission time of Wed Sep 5 16:14:45 2007 is more than 345600 seconds older than current time (Sun Sep 9 19:55:38 2007).
Update comment by auto on 05 Sep 2007 19:40
SSAP job SID0011392015429120 is not yet finished.
Flow stage update by auto on 05 Sep 2007 16:14
The entry "2or0A03" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 05 Sep 2007 16:14
The entry "2or0A03" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 09:53
Retrieved PRC results for job ID SID5866895228829952 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 09:52
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 13 results for 2or0A03
Prc cath submit by auto on 05 Sep 2007 03:50
The entry "2or0A03" has been submitted to the PRC webservice.
Flow stage update by auto on 05 Sep 2007 03:50
The entry "2or0A03" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Sep 2007 22:46
Retrieved HMM(SAM) results for job ID SID4550754165701360 and inserted them into the database.
Domain scan sam cath by auto on 04 Sep 2007 22:45
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 2or0A03
Update comment by auto on 04 Sep 2007 12:12
HMM(SAM) job SID4550754165701360 is not yet finished.
Flow stage update by auto on 04 Sep 2007 10:03
The entry "2or0A03" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 04 Sep 2007 10:03
The entry "2or0A03" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 02:43
Retrieved "2or0A03" CATHEDRAL results for job ID SID6679581015729152 and inserted them into the database.
Domain scan cathedral cath by auto on 04 Sep 2007 02:42
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 78 results for 2or0A03
Flow stage update by auto on 03 Sep 2007 14:08
The entry "2or0A03" has been submitted to the CATHEDRAL webservice.
Cathedral cath submit by auto on 03 Sep 2007 14:08
The entry "2or0A03" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 12:09
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2or0A03.scanlist" for "2or0A03"
Write scan list by auto on 03 Sep 2007 12:09
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2or0A03.scanlist" for domain "2or0A03"
Update comment by auto on 03 Sep 2007 10:11
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:31
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:36
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:32
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 18:21
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 14:21
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 10:15
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 02:27
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 22:12
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 18:14
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 14:16
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 11:41
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 06:15
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 03:32
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Aug 2007 20:06
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Flow stage update by auto on 31 Aug 2007 20:00
No satisfactory AssignClose result found.
Flow stage update by auto on 31 Aug 2007 19:48
No in_process hits for Domain "2or0A03" ready to be processed
Flow stage update by auto on 31 Aug 2007 19:48
NW result present for Domain "2or0A03"
Flow stage update by auto on 24 Aug 2007 10:06
All required files are present for Domain "2or0A03"
Flow stage update by auto on 23 Aug 2007 18:40
Beginning processing for Domain "2or0A03"
Insertion by cuff on 23 Aug 2007 11:57
nice chopping
