CATH Domain: 2oqhB01 XML data for domain: 2oqhB01

Molscript image for 2oqhB01
2oqhB01
PDB coordinates for domain 2oqhB01

PDB 2oqh, Chain B, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.390 Enolase-like; domain 1
3.30.390.10 Enolase-like, N-terminal domain Gene3D
3.30.390.10.12
3.30.390.10.12.1
3.30.390.10.12.1.1
3.30.390.10.12.1.1.1
3.30.390.10.12.1.1.1.1

[top]
Segment boundaries for domain 2oqhB01

Chopping figure for domain 2oqhB01
DomainStart PDB ResidueStop PDB Residue
2oqhB01 3 113
2oqhB01 355 376
2oqhB02 114 354

Structural Neighbourhood (11 entries)

There are 11 matching structural neighberhood comparisons for CATH ID 3.30.390.10.12.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 11 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ec7C01 88.73 Ascorbate and aldarate metabolismD-glucarate catabolic processGlucarate dehydratase activityGlucarate dehydrataseGlucarate dehydratase [EC:4.2.1.40] 3.30.390.10 136 17 89 3.42 3.81
3go2A01 87.35 Burkholderia xenovorans LB400Putative uncharacterized protein 3.30.390.10 114 22 81 1.70 2.09
2ovlA01 86.91 Toluene and xylene degradationStreptomyces coelicolorMandelate racemase [EC:5.1.2.2]Benzoate degradation via hydroxylationPutative racemase 3.30.390.10 123 25 88 3.77 4.27
2qq6B01 86.75 Rubrobacter xylanophilus DSM 9941Mandelate racemase/muconate lactonizing enzyme-like protein 3.30.390.10 115 22 79 1.98 2.48
3bjsA01 86.61 Polaromonas sp. JS666Mandelate racemase/muconate lactonizing enzyme 3.30.390.10 116 23 81 3.63 4.46
2qjjA01 85.77 Mandelate racemase/muconate lactonizing enzyme, N-terminal domain proteinStarvation sensing protein RspANovosphingobium aromaticivorans DSM 12444 3.30.390.10 140 27 79 2.05 2.59
2pgwA01 85.69 Sinorhizobium melilotiToluene and xylene degradationBenzoate degradation via hydroxylationMuconate cycloisomerase [EC:5.5.1.1]Mandelate racemase/muconate lactonizing enzyme family protein 3.30.390.10 147 25 82 3.37 4.06
2oqyA01 85.63 Muconate cycloisomeraseOceanobacillus iheyensis 3.30.390.10 142 22 78 2.48 3.17
1tzzB01 83.77 Bradyrhizobium japonicumBll6730 protein 3.30.390.10 119 20 72 2.65 3.64
1jpdX01 83.68 Racemase and epimerase activity, acting on amino acids and derivativesL-Ala-D/L-Glu epimeraseEscherichia coli K-12 3.30.390.10 99 23 68 2.49 3.61
2nqlA01 82.03 Agrobacterium tumefaciens str. C58Isomerase/lactonizing enzyme 3.30.390.10 162 27 68 2.63 3.84
[1]
Displaying entries 1 to 11 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2oqhB01
LKITDVDVWVVNLPLVNPFTSSFETKTGETRTVVRVRTDSGVEGWGETWGAPVAAIVRRAPDLIGTSPFALEAFHRKQHV
PFFYGYLGYAAIAAVDVACWDAGKATGVSVDEDKLRHYAGVNERDGDLT
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2oqhB01
XSLKITDVDVWVVNLPLVNPFTSSFETKTGETRTVVRVRTDSGVEGWGETXWGAPVAAIVRRXAPDLIGTSPFALEAFHR
KQHXVPFFYGYLGYAAIAAVDVACWDAXGKATGVSVDEDKLRHYAGVNERDGDLTGEGHHHHHH
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 21 Feb 2008 16:30

Assigning to "3.30.390.10" based on similarity with "2oqhA01"

Flow stage update by auto on 21 Feb 2008 16:16

No in_process hits for Domain "2oqhB01" ready to be processed

Update comment by auto on 06 Sep 2007 22:06

Domain "2oqhB01" hits Domain "2oqhA01" (95.9349593495935% over 85.4166666666667%) which is currently in process

Flow stage update by auto on 06 Sep 2007 22:05

Domain "2oqhB01" hits Domain "2oqhA01" (95.9349593495935% over 85.4166666666667%) which is currently in process

Flow stage update by auto on 06 Sep 2007 22:05

NW result present for Domain "2oqhB01"

Flow stage update by auto on 04 Sep 2007 14:04

All required files are present for Domain "2oqhB01"

Flow stage update by auto on 03 Sep 2007 20:09

Beginning processing for Domain "2oqhB01"

Insertion by cuff on 03 Sep 2007 14:13

nice chopping