CATH Domain: 2oqhA02 XML data for domain: 2oqhA02

Molscript image for 2oqhA02
2oqhA02
PDB coordinates for domain 2oqhA02

PDB 2oqh, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.20 Alpha-Beta Barrel
3.20.20 TIM Barrel
3.20.20.120 Enolase superfamily Gene3D
3.20.20.120.16
3.20.20.120.16.1
3.20.20.120.16.1.1
3.20.20.120.16.1.1.1
3.20.20.120.16.1.1.1.1

[top]
Segment boundaries for domain 2oqhA02

Chopping figure for domain 2oqhA02
DomainStart PDB ResidueStop PDB Residue
2oqhA01 2 15
2oqhA01 21 113
2oqhA01 355 369
2oqhA02 16 20
2oqhA02 114 354

Structural Neighbourhood (22 entries)

There are 22 matching structural neighberhood comparisons for CATH ID 3.20.20.120.16.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 22 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ec7A02 86.47 Ascorbate and aldarate metabolismD-glucarate catabolic processGlucarate dehydratase activityGlucarate dehydrataseGlucarate dehydratase [EC:4.2.1.40] 3.20.20.120 261 26 85 2.10 2.47
1tkkA02 85.51 Bacillus subtilisL-Ala-D/L-Glu epimerase 3.20.20.120 244 22 91 2.97 3.24
3cb3A02 85.38 Toluene and xylene degradationPolaromonas sp. JS666Mandelate racemase [EC:5.1.2.2]Mandelate racemase/muconate lactonizing enzymeBenzoate degradation via hydroxylation 3.20.20.120 233 26 91 2.61 2.86
2qddA02 84.99 Mandelate racemase/muconate lactonizing enzyme, putativeRoseovarius nubinhibens ISM 3.20.20.120 236 23 92 1.98 2.15
2pgwA02 84.51 Sinorhizobium melilotiToluene and xylene degradationBenzoate degradation via hydroxylationMuconate cycloisomerase [EC:5.5.1.1]Mandelate racemase/muconate lactonizing enzyme family protein 3.20.20.120 215 28 86 2.16 2.50
2chrA02 84.47 Ralstonia eutropha JMP134Chloromuconate cycloisomeraseToluene and xylene degradationMuconate cycloisomerase [EC:5.5.1.1]Benzoate degradation via hydroxylation 3.20.20.120 202 22 79 1.86 2.34
3bjsA02 84.24 Polaromonas sp. JS666Mandelate racemase/muconate lactonizing enzyme 3.20.20.120 250 23 88 2.11 2.40
2oqyA02 84.24 Muconate cycloisomeraseOceanobacillus iheyensis 3.20.20.120 226 21 89 2.63 2.95
2pozH02 84.03 Putative dehydrataseMesorhizobium loti 3.20.20.120 246 22 89 2.11 2.37
2ovlA02 83.96 Toluene and xylene degradationStreptomyces coelicolorMandelate racemase [EC:5.1.2.2]Benzoate degradation via hydroxylationPutative racemase 3.20.20.120 223 26 88 2.28 2.58
2qq6A02 83.60 Rubrobacter xylanophilus DSM 9941Mandelate racemase/muconate lactonizing enzyme-like protein 3.20.20.120 262 25 85 2.51 2.95
1mdlA02 82.95 Mandelate racemasePseudomonas putida 3.20.20.120 230 23 90 2.41 2.65
2nqlA02 82.53 Agrobacterium tumefaciens str. C58Isomerase/lactonizing enzyme 3.20.20.120 214 17 85 2.50 2.91
1jpdX02 82.47 Racemase and epimerase activity, acting on amino acids and derivativesL-Ala-D/L-Glu epimeraseEscherichia coli K-12 3.20.20.120 207 20 83 2.07 2.47
2podB02 82.22 Mandelate racemase / muconate lactonizing enzymeBurkholderia pseudomallei 3.20.20.120 251 17 90 3.84 4.25
2oz8A02 82.05 Mesorhizobium lotiMll7089 protein 3.20.20.120 230 16 89 3.03 3.38
3go2A02 81.96 Burkholderia xenovorans LB400Putative uncharacterized protein 3.20.20.120 268 20 85 3.91 4.58
3cyjA02 81.91 Rubrobacter xylanophilus DSM 9941Mandelate racemase/muconate lactonizing enzyme-like proteinToluene and xylene degradationMandelate racemase [EC:5.1.2.2]Benzoate degradation via hydroxylation 3.20.20.120 235 21 90 2.77 3.06
2hzgA02 81.88 Rhodobacter sphaeroides 2.4.1Mandelate racemase/muconate lactonizing enzyme/Enolase superfamily 3.20.20.120 248 19 89 2.82 3.16
1yeyB02 81.80 Xanthomonas campestris pv. campestrisRTS beta protein 3.20.20.120 243 20 86 2.61 3.03
1r6wA01 79.95 Ubiquinone and other terpenoid-quinone biosynthesisMetabolic pathwaysMenaquinone biosynthetic processO-succinylbenzoate synthaseHydro-lyase activity 3.20.20.120 198 14 79 2.98 3.74
3cawA02 79.86 Ubiquinone and other terpenoid-quinone biosynthesisO-succinylbenzoate synthase [EC:4.2.1.113]Bdellovibrio bacteriovorusMetabolic pathwaysPutative uncharacterized protein 3.20.20.120 225 16 88 3.07 3.46
[1]
Displaying entries 1 to 22 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2oqhA02
PLVNPQSVTDLLGGAVRDEVPITALITRADAPGATPADLPKAAEHAVRVVEEGGFDAVKLKGTTDCAGDVAILRAVREAL
PGVNLRVDPNAAWSVPDSVRAGIALEELDLEYLEDPCVGIEGAQVKAKVRIPLCTNCVVRFEDFAPARLNAVDVIHGDVY
KWGGIAATKALAAHCETFGLGNLHSGGELGIATAAHLAVVSSTPVLSRAIDSYYLHADDIIEPLHLENGRLRVPSGPGLG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2oqhA02
PLVNPQSVTDLLGGAVRDEVPITALITRADAPGATPADLPKAXAEHAVRVVEEGGFDAVKLKGTTDCAGDVAILRAVREA
LPGVNLRVDPNAAWSVPDSVRAGIALEELDLEYLEDPCVGIEGXAQVKAKVRIPLCTNXCVVRFEDFAPAXRLNAVDVIH
GDVYKWGGIAATKALAAHCETFGLGXNLHSGGELGIATAAHLAVVSSTPVLSRAIDSXYYLHADDIIEPLHLENGRLRVP
SGPGLG
BLAST against CATH

[top]
Domain History Events (59)

Domain assigned by cuff on 21 Feb 2008 17:41

same superfamily

Domain assignment manual match h by cuff on 21 Feb 2008 17:40

all results indicate homology

Domain assignment manual match t by tronnberg on 17 Sep 2007 10:47

SSAP: 86.8 OV: 91 SEQ: 29. Very similar linkage and structure. No details is given in PDBsum on the query's fucntion except that the query is a isomerase.

Homcheck review by tronnberg on 17 Sep 2007 10:47

SSAP: 86.8 OV: 91 SEQ: 29. Very similar linkage and structure. No details is given in PDBsum on the query's fucntion except that the query is a isomerase.

Flow stage update by tronnberg on 17 Sep 2007 10:47

SSAP: 86.8 OV: 91 SEQ: 29. Very similar linkage and structure. No details is given in PDBsum on the query's fucntion except that the query is a isomerase.

Homcheck allotment by tronnberg on 17 Sep 2007 10:40

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 17 Sep 2007 10:40

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 15 Sep 2007 18:43

Domain "2oqhA02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 15 Sep 2007 18:42

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2oqhA02

Flow stage update by auto on 15 Sep 2007 14:49

Retrieved PRC_PFAMCATH results for job ID SID7271037745395584 and results inserted.

Domain scan prc pfamcath by auto on 15 Sep 2007 14:48

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 117 results for 2oqhA02

Update comment by auto on 15 Sep 2007 09:05

PRC_PFAMCATH job SID7271037745395584 is not yet finished.

Flow stage update by auto on 15 Sep 2007 08:35

The entry "2oqhA02" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 15 Sep 2007 08:35

The entry "2oqhA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 12 Sep 2007 10:18

Retrieved SSAP results for job ID SID0641099881945568 and results inserted.

Domain scan ssap cath by auto on 12 Sep 2007 10:16

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 817 results for 2oqhA02

Update comment by auto on 09 Sep 2007 23:05

SSAP job SID0641099881945568 is not yet finished.

Ssap cath submit by auto on 09 Sep 2007 22:21

The entry "2oqhA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 22:21

The entry "2oqhA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 19:54

Giving up on SSAP job SID8978586445496832 because submission time of Wed Sep 5 16:13:27 2007 is more than 345600 seconds older than current time (Sun Sep 9 19:54:52 2007).

Update comment by auto on 05 Sep 2007 19:39

SSAP job SID8978586445496832 is not yet finished.

Flow stage update by auto on 05 Sep 2007 16:13

The entry "2oqhA02" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 05 Sep 2007 16:13

The entry "2oqhA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 09:45

Retrieved PRC results for job ID SID0008084562994368 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 09:44

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 44 results for 2oqhA02

Prc cath submit by auto on 05 Sep 2007 03:49

The entry "2oqhA02" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 03:49

The entry "2oqhA02" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 22:40

Retrieved HMM(SAM) results for job ID SID0324178437642784 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 22:39

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 35 results for 2oqhA02

Update comment by auto on 04 Sep 2007 12:11

HMM(SAM) job SID0324178437642784 is not yet finished.

Sam cath submit by auto on 04 Sep 2007 10:02

The entry "2oqhA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 10:02

The entry "2oqhA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 02:35

Retrieved "2oqhA02" CATHEDRAL results for job ID SID2564253941129568 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 02:34

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 129 results for 2oqhA02

Flow stage update by auto on 03 Sep 2007 14:07

The entry "2oqhA02" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 03 Sep 2007 14:07

The entry "2oqhA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:08

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2oqhA02.scanlist" for "2oqhA02"

Write scan list by auto on 03 Sep 2007 12:08

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2oqhA02.scanlist" for domain "2oqhA02"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:31

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:36

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:32

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:21

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:21

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:15

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:27

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:12

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:14

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:16

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:41

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:15

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:32

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:06

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 31 Aug 2007 20:00

No satisfactory AssignClose result found.

Flow stage update by auto on 31 Aug 2007 19:48

No in_process hits for Domain "2oqhA02" ready to be processed

Flow stage update by auto on 31 Aug 2007 19:48

NW result present for Domain "2oqhA02"

Flow stage update by auto on 24 Aug 2007 10:06

All required files are present for Domain "2oqhA02"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2oqhA02"

Insertion by cuff on 23 Aug 2007 11:57

nice chopping