CATH Domain: 2oqeA02 XML data for domain: 2oqeA02

Molscript image for 2oqeA02
2oqeA02
PDB coordinates for domain 2oqeA02

PDB 2oqe, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.450 Nuclear Transport Factor 2; Chain: A,
3.10.450.40 Gene3D
3.10.450.40.6
3.10.450.40.6.1
3.10.450.40.6.1.1
3.10.450.40.6.1.1.1
3.10.450.40.6.1.1.1.1

[top]
Segment boundaries for domain 2oqeA02

Chopping figure for domain 2oqeA02
DomainStart PDB ResidueStop PDB Residue
2oqeA01 17 117
2oqeA02 123 231
2oqeA03 232 670

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.10.450.40.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1oacA04 87.73 Tyrosine metabolismGlycine, serine and threonine metabolismPhenylalanine metabolismMetabolic pathwaysBeta-Alanine metabolism 3.10.450.40 106 21 87 1.69 1.93
1ksiA02 83.35 Pisum sativumPrimary amine oxidase 3.10.450.40 96 12 80 2.39 2.98
1tu5B02 75.84 Tyrosine metabolismAmine metabolic processBos taurusCopper ion bindingPrimary-amine oxidase [EC:1.4.3.21] 3.10.450.40 122 12 71 3.48 4.88
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2oqeA02
STEEVIRNDPAVIEQCVLSGIPANEMHKVYCDPWTIGYDERWGTGKRLQQALVYYRSDEDDSQYSHPLDFCPIVDTEEKK
VIFIDIPNRRRKVSKHKHANFYPKHMIEK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2oqeA02
STEEVIRNDPAVIEQCVLSGIPANEMHKVYCDPWTIGYDERWGTGKRLQQALVYYRSDEDDSQYSHPLDFCPIVDTEEKK
VIFIDIPNRRRKVSKHKHANFYPKHMIEK
BLAST against CATH

[top]
Domain History Events (12)

Domain assigned by auto on 15 Aug 2007 04:21

Assigning to "3.10.450.40" based on similarity with "1a2vA02"

Flow stage update by auto on 15 Aug 2007 04:02

No in_process hits for Domain "2oqeA02" ready to be processed

Update comment by auto on 15 Aug 2007 03:23

Domain "2oqeA02" hits Domain "2oqeD02" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 02:40

Domain "2oqeA02" hits Domain "2oovD02" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 01:42

Domain "2oqeA02" hits Domain "2oovA02" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 00:10

Domain "2oqeA02" hits Domain "2oovE02" (100% over 100%) which is currently in process

Update comment by auto on 14 Aug 2007 22:51

Domain "2oqeA02" hits Domain "2oovB02" (100% over 100%) which is currently in process

Flow stage update by auto on 03 Aug 2007 10:34

Domain "2oqeA02" hits Domain "2oqeE02" (100% over 100%) which is currently in process

Flow stage update by auto on 03 Aug 2007 10:34

NW result present for Domain "2oqeA02"

Flow stage update by auto on 16 Jul 2007 22:39

All required files are present for Domain "2oqeA02"

Flow stage update by auto on 15 Jul 2007 19:15

Beginning processing for Domain "2oqeA02"

Insertion by auto on 15 Jul 2007 18:32

Final ChopClose added based on similarity with "2oovA"