CATH Domain: 2oqeA01 XML data for domain: 2oqeA01

Molscript image for 2oqeA01
2oqeA01
PDB coordinates for domain 2oqeA01

PDB 2oqe, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.450 Nuclear Transport Factor 2; Chain: A,
3.10.450.40 Gene3D
3.10.450.40.2
3.10.450.40.2.1
3.10.450.40.2.1.1
3.10.450.40.2.1.1.1
3.10.450.40.2.1.1.1.3

[top]
Segment boundaries for domain 2oqeA01

Chopping figure for domain 2oqeA01
DomainStart PDB ResidueStop PDB Residue
2oqeA01 17 117
2oqeA02 123 231
2oqeA03 232 670

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 3.10.450.40.2.1.1.1.3 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ksiA01 88.15 Pisum sativumPrimary amine oxidase 3.10.450.40 96 19 91 2.03 2.23
1tu5A01 85.85 Tyrosine metabolismAmine metabolic processBos taurusCopper ion bindingPrimary-amine oxidase [EC:1.4.3.21] 3.10.450.40 108 17 81 2.04 2.50
1w7cA02 85.58 Pichia pastorisLysyl oxidase 3.10.450.40 117 15 80 2.41 3.00
1w6gA01 85.36 Phenylethylamine oxidaseArthrobacter globiformis 3.10.450.40 87 20 84 2.52 2.99
3hi7B01 85.31 Diamine oxidase [EC:1.4.3.22]Arginine and proline metabolismAmiloride-sensitive amine oxidase [copper-containing]Homo sapiensPrimary amine oxidase activity 3.10.450.40 110 20 84 2.71 3.21
2gu3A02 78.84 Uncharacterized protein ypmBBacillus subtilis 3.10.450.40 63 12 61 2.58 4.18
2gu3A01 77.41 Uncharacterized protein ypmBBacillus subtilis 3.10.450.40 65 9 63 2.72 4.27
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2oqeA01
APARPAHPLDPLSTAEIKAATNTVKSYFAGKKISFNTVTLREPARKAYIQWKEQGGPLPPRLAYYVILEAGKPGVKEGLV
DLASLSVIETRALETVQPILT
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2oqeA01
AASAAPARPAHPLDPLSTAEIKAATNTVKSYFAGKKISFNTVTLREPARKAYIQWKEQGGPLPPRLAYYVILEAGKPGVK
EGLVDLASLSVIETRALETVQPILT
BLAST against CATH

[top]
Domain History Events (15)

Domain assigned by auto on 15 Aug 2007 05:50

Assigning to "3.10.450.40" based on similarity with "2oqeD01"

Flow stage update by auto on 15 Aug 2007 05:40

No in_process hits for Domain "2oqeA01" ready to be processed

Update comment by auto on 15 Aug 2007 05:08

Domain "2oqeA01" hits Domain "2oqeC01" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 04:37

Domain "2oqeA01" hits Domain "2oqeB01" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 04:02

Domain "2oqeA01" hits Domain "2oqeF01" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 03:23

Domain "2oqeA01" hits Domain "2oqeE01" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 02:40

Domain "2oqeA01" hits Domain "2oovD01" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 01:42

Domain "2oqeA01" hits Domain "2oovA01" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 00:09

Domain "2oqeA01" hits Domain "2oovE01" (100% over 100%) which is currently in process

Update comment by auto on 14 Aug 2007 22:51

Domain "2oqeA01" hits Domain "2oovB01" (100% over 100%) which is currently in process

Flow stage update by auto on 03 Aug 2007 10:34

Domain "2oqeA01" hits Domain "2oqeD01" (100% over 100%) which is currently in process

Flow stage update by auto on 03 Aug 2007 10:34

NW result present for Domain "2oqeA01"

Flow stage update by auto on 16 Jul 2007 22:39

All required files are present for Domain "2oqeA01"

Flow stage update by auto on 15 Jul 2007 19:15

Beginning processing for Domain "2oqeA01"

Insertion by auto on 15 Jul 2007 18:32

Final ChopClose added based on similarity with "2oovA"