CATH Domain: 2oq1A03 XML data for domain: 2oq1A03

Molscript image for 2oq1A03
2oq1A03
PDB coordinates for domain 2oq1A03

PDB 2oq1, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.505 SHC Adaptor Protein
3.30.505.10 SHC Adaptor Protein Gene3D
3.30.505.10.10
3.30.505.10.10.1
3.30.505.10.10.1.1
3.30.505.10.10.1.1.1
3.30.505.10.10.1.1.1.1

[top]
Segment boundaries for domain 2oq1A03

Chopping figure for domain 2oq1A03
DomainStart PDB ResidueStop PDB Residue
2oq1A01 5 113
2oq1A02 114 158
2oq1A03 159 258

Structural Neighbourhood (15 entries)

There are 15 matching structural neighberhood comparisons for CATH ID 3.30.505.10.10.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 15 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2oq1A01 92.69 T cell receptor complexZeta-chain (TCR) associated protein kinase [EC:2.7.10.2]Natural killer cell mediated cytotoxicityPositive thymic T cell selectionTyrosine-protein kinase ZAP-70 3.30.505.10 108 31 90 1.15 1.27
1i3zA00 89.80 Mus musculusSH2 domain-containing protein 1BNegative regulation of natural killer cell mediated cytotoxicityNegative regulation of peptidyl-tyrosine phosphorylationPhosphotyrosine binding 3.30.505.10 102 33 94 1.88 2.00
1ayaA00 89.54 Hormone-mediated signaling pathwayRegulation of multicellular organism growthNerve growth factor receptor signaling pathwayTriglyceride metabolic processNegative regulation of insulin secretion 3.30.505.10 101 33 93 1.82 1.96
2shpA02 89.37 Tyrosine-protein phosphatase non-receptor type 11Homo sapiens 3.30.505.10 101 30 90 1.66 1.84
2dm0A01 88.67 Tyrosine-protein kinase TXKProtein phosphorylationTXK tyrosine kinase [EC:2.7.10.2]Leukocyte transendothelial migrationHomo sapiens 3.30.505.10 97 27 91 1.66 1.81
1milA00 88.10 Transmembrane receptor protein tyrosine kinase adaptor activitySHC-transforming protein 1Regulation of epidermal growth factor receptor activityEpidermal growth factor receptor signaling pathwayInsulin-like growth factor receptor binding 3.30.505.10 104 25 89 1.86 2.08
2iugA00 88.09 ErbB-3 class receptor bindingInsulin-like growth factor receptor signaling pathwayInsulin receptor signaling pathwayGrowth hormone receptor signaling pathwayInsulin-like growth factor receptor binding 3.30.505.10 110 24 87 1.91 2.19
2crhA01 87.97 Vav oncogeneChemokine signaling pathwayB cell receptor signaling pathwayLeukocyte transendothelial migrationFc gamma R-mediated phagocytosis 3.30.505.10 102 30 92 1.87 2.03
3bkbA01 86.89 Tyrosine-protein kinase Fes/FpsHomo sapiensCell proliferationMulticellular organismal development 3.30.505.10 93 23 87 3.13 3.56
2kk6A00 85.09 CytoplasmFer (fps/fes related) tyrosine kinase [EC:2.7.10.2]Homo sapiensAdherens junctionTyrosine-protein kinase Fer 3.30.505.10 116 26 80 1.67 2.08
2pldA00 85.02 Phosphatidylinositol signaling systemCalcium signaling pathwayPhospholipase C, gamma [EC:3.1.4.11]Pathways in cancerNeurotrophin signaling pathway 3.30.505.10 105 28 91 2.87 3.14
1ju5A00 85.02 Pathways in cancerChemokine signaling pathwayNeurotrophin signaling pathwayFc gamma R-mediated phagocytosisErbB signaling pathway 3.30.505.10 109 28 83 2.07 2.48
2vifA01 83.74 CytoplasmJAK-STAT cascadeDefense responseSuppressor of cytokine signaling 6Suppressor of cytokine signaling 6 3.30.505.10 126 23 76 2.69 3.53
1rpyB00 83.66 SH2B adapter protein 2Nervous system developmentRattus norvegicusInsulin signaling pathwayNeurotrophin signaling pathway 3.30.505.10 85 16 76 3.77 4.91
1uurA04 78.69 Protein homodimerization activityNucleusSignal transducer and activator of transcription APositive regulation of transcriptionCytosol 3.30.505.10 132 13 59 2.22 3.71
[1]
Displaying entries 1 to 15 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2oq1A03
AHERPWYHSSLTREEAERKLYSGAQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVE
YLKLKADGLIYCLKEACPN
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2oq1A03
AHERXPWYHSSLTREEAERKLYSGAQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLV
EYLKLKADGLIYCLKEACPN
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 22 Aug 2007 06:24

Assigning to "3.30.505.10" based on similarity with "1m61A03"

Flow stage update by auto on 22 Aug 2007 06:13

No in_process hits for Domain "2oq1A03" ready to be processed

Flow stage update by auto on 22 Aug 2007 06:13

NW result present for Domain "2oq1A03"

Flow stage update by auto on 16 Aug 2007 17:16

All required files are present for Domain "2oq1A03"

Flow stage update by auto on 16 Aug 2007 00:03

Beginning processing for Domain "2oq1A03"

Insertion by auto on 15 Aug 2007 18:36

Final ChopClose added based on similarity with "1a81A"