CATH Domain: 2oq1A01 XML data for domain: 2oq1A01

Molscript image for 2oq1A01
2oq1A01
PDB coordinates for domain 2oq1A01

PDB 2oq1, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.505 SHC Adaptor Protein
3.30.505.10 SHC Adaptor Protein Gene3D
3.30.505.10.14
3.30.505.10.14.1
3.30.505.10.14.1.1
3.30.505.10.14.1.1.1
3.30.505.10.14.1.1.1.1

[top]
Segment boundaries for domain 2oq1A01

Chopping figure for domain 2oq1A01
DomainStart PDB ResidueStop PDB Residue
2oq1A01 5 113
2oq1A02 114 158
2oq1A03 159 258

Structural Neighbourhood (9 entries)

There are 9 matching structural neighberhood comparisons for CATH ID 3.30.505.10.14.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 9 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2iugA00 89.41 ErbB-3 class receptor bindingInsulin-like growth factor receptor signaling pathwayInsulin receptor signaling pathwayGrowth hormone receptor signaling pathwayInsulin-like growth factor receptor binding 3.30.505.10 110 24 92 2.42 2.61
1i3zA00 89.40 Mus musculusSH2 domain-containing protein 1BNegative regulation of natural killer cell mediated cytotoxicityNegative regulation of peptidyl-tyrosine phosphorylationPhosphotyrosine binding 3.30.505.10 102 25 89 1.74 1.94
1milA00 88.38 Transmembrane receptor protein tyrosine kinase adaptor activitySHC-transforming protein 1Regulation of epidermal growth factor receptor activityEpidermal growth factor receptor signaling pathwayInsulin-like growth factor receptor binding 3.30.505.10 104 23 90 2.15 2.37
2crhA01 87.12 Vav oncogeneChemokine signaling pathwayB cell receptor signaling pathwayLeukocyte transendothelial migrationFc gamma R-mediated phagocytosis 3.30.505.10 102 29 89 2.14 2.38
2dm0A01 86.98 Tyrosine-protein kinase TXKProtein phosphorylationTXK tyrosine kinase [EC:2.7.10.2]Leukocyte transendothelial migrationHomo sapiens 3.30.505.10 97 23 84 1.84 2.18
2kk6A00 86.06 CytoplasmFer (fps/fes related) tyrosine kinase [EC:2.7.10.2]Homo sapiensAdherens junctionTyrosine-protein kinase Fer 3.30.505.10 116 25 87 2.75 3.16
2vifA01 85.25 CytoplasmJAK-STAT cascadeDefense responseSuppressor of cytokine signaling 6Suppressor of cytokine signaling 6 3.30.505.10 126 25 80 2.48 3.06
1ju5A00 84.63 Pathways in cancerChemokine signaling pathwayNeurotrophin signaling pathwayFc gamma R-mediated phagocytosisErbB signaling pathway 3.30.505.10 109 25 84 2.16 2.56
2pldA00 83.67 Phosphatidylinositol signaling systemCalcium signaling pathwayPhospholipase C, gamma [EC:3.1.4.11]Pathways in cancerNeurotrophin signaling pathway 3.30.505.10 105 20 94 4.51 4.78
[1]
Displaying entries 1 to 9 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2oq1A01
DPAAHLPFFYGSISRAEAEEHLKLAGADGLFLLRQCLRSLGGYVLSLVHDVRFHHFPIERQLNGTYAIAGGKAHCGPAEL
CEFYSRDPDGLPCNLRKPCNRPSGLEPQ
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2oq1A01
DPAAHLPFFYGSISRAEAEEHLKLAGXADGLFLLRQCLRSLGGYVLSLVHDVRFHHFPIERQLNGTYAIAGGKAHCGPAE
LCEFYSRDPDGLPCNLRKPCNRPSGLEPQ
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 22 Aug 2007 06:24

Assigning to "3.30.505.10" based on similarity with "1m61A01"

Flow stage update by auto on 22 Aug 2007 06:13

No in_process hits for Domain "2oq1A01" ready to be processed

Flow stage update by auto on 22 Aug 2007 06:13

NW result present for Domain "2oq1A01"

Flow stage update by auto on 16 Aug 2007 17:16

All required files are present for Domain "2oq1A01"

Flow stage update by auto on 16 Aug 2007 00:03

Beginning processing for Domain "2oq1A01"

Insertion by auto on 15 Aug 2007 18:36

Final ChopClose added based on similarity with "1a81A"