CATH Domain: 2oq0C01 XML data for domain: 2oq0C01

Molscript image for 2oq0C01
2oq0C01
PDB coordinates for domain 2oq0C01

PDB 2oq0, Chain C, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.40 Beta Barrel
2.40.50 OB fold (Dihydrolipoamide Acetyltransferase, E2P)
2.40.50.140 Nucleic acid-binding proteins Gene3D
2.40.50.140.10
2.40.50.140.10.1
2.40.50.140.10.1.1
2.40.50.140.10.1.1.1
2.40.50.140.10.1.1.1.1

[top]
Segment boundaries for domain 2oq0C01

Chopping figure for domain 2oq0C01
DomainStart PDB ResidueStop PDB Residue
2oq0C01 11 113
2oq0C02 114 202

Structural Neighbourhood (21 entries)

There are 21 matching structural neighberhood comparisons for CATH ID 2.40.50.140.10.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 21 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1fguB01 83.36 Replication factor A1DNA-dependent DNA replicationDNA replicationNucleotide excision repairReplication protein A 70 kDa DNA-binding subunit 2.40.50.140 105 7 78 2.35 3.01
1jmcA02 82.08 Replication factor A1DNA-dependent DNA replicationNucleotide excision repairDNA replicationPML body 2.40.50.140 124 9 75 2.52 3.32
1ltlA02 80.99 Methanothermobacter thermautotrophicus str. Delta HDNA replication initiator (Cdc21/Cdc54)Replicative DNA helicase Mcm [EC:3.6.1.-] 2.40.50.140 100 6 70 2.50 3.56
1miuA03 79.98 HemopoiesisInner cell mass cell proliferationResponse to X-rayPositive regulation of mitotic cell cycleDNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator 2.40.50.140 117 8 75 3.16 4.20
3lgjB00 79.82 DNA replicationHomologous recombinationBartonella henselaeSingle-strand DNA-binding proteinSingle-stranded DNA-binding protein 2.40.50.140 96 8 78 2.59 3.31
1wocC00 79.59 Homologous recombinationPrimosomal replication protein NEscherichia coli K-12Primosomal replication protein n 2.40.50.140 98 6 73 2.21 3.02
2oq0B02 79.46 Gamma-interferon-inducible protein 16NucleolusMonocyte differentiationDouble-stranded DNA bindingProtein binding 2.40.50.140 86 5 70 2.57 3.66
1jb7A02 79.12 Telomere-binding protein subunit alphaSterkiella nova 2.40.50.140 116 9 78 3.18 4.05
2vw9B00 78.25 Homologous recombinationDNA replicationHelicobacter pyloriSingle-strand DNA-binding proteinSingle-stranded DNA-binding protein 2.40.50.140 105 5 71 2.52 3.53
1nnxA00 78.12 Escherichia coli O157:H7Protein ygiW 2.40.50.200 93 3 66 2.64 3.98
1lm0A00 77.75 Cytochrome c-type biogenesis protein ccmECytochrome c-type biogenesis protein CcmEShewanella oneidensis 2.40.50.140 101 13 74 3.41 4.59
2jqoA01 77.60 Bacillus subtilisUncharacterized protein yobA 2.40.50.140 88 6 63 2.13 3.36
3ullA00 77.11 DNA replicationPositive regulation of helicase activityMitochondrial nucleoidSingle-stranded DNA-binding protein, mitochondrialHomologous recombination 2.40.50.140 106 6 73 3.26 4.43
2hqlA01 76.53 Uncharacterized protein MG376 homologMycoplasma pneumoniae 2.40.50.140 91 9 69 3.13 4.52
2ztdA01 75.47 Homologous recombinationHolliday junction ATP-dependent DNA helicase ruvAHolliday junction DNA helicase RuvAMycobacterium tuberculosis 2.40.50.140 71 8 62 2.72 4.36
2zteA01 75.13 Homologous recombinationHolliday junction ATP-dependent DNA helicase ruvAHolliday junction DNA helicase RuvAMycobacterium tuberculosis 2.40.50.140 65 9 60 2.61 4.32
1cukA01 74.94 Homologous recombinationHolliday junction ATP-dependent DNA helicase ruvAHolliday junction DNA helicase RuvAEscherichia coli K-12 2.40.50.140 66 9 61 2.72 4.43
1c9oA00 73.57 Bacillus caldolyticusCold shock protein cspBCold shock protein (beta-ribbon, CspA family) 2.40.50.140 66 6 60 2.99 4.95
1y14D02 73.23 Pyrimidine metabolismNuclear-transcribed mRNA catabolic process, exonucleolyticCytoplasmic mRNA processing bodyPurine metabolismPositive regulation of nuclear-transcribed mRNA poly(A) tail shortening 2.40.50.140 87 10 60 2.96 4.90
1khiA02 72.85 Neurospora crassaWoronin body major protein 2.40.50.140 72 8 61 2.94 4.79
1g29102 72.22 Maltose transport protein MalKThermococcus litoralis 2.40.50.140 45 6 44 1.69 3.79
[1]
Displaying entries 1 to 21 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2oq0C01
NVLQKRPVIVKVLSTTKPFEYETPEEKKIFHATVATQTQFFHVKVLNTSLKEKFNGKKIIIISDYLEYDSLLEVNEESTV
SEAGPNQTFEVPNKIINRAKE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2oq0C01
GSHXQVTPRRNVLQKRPVIVKVLSTTKPFEYETPEXEKKIXFHATVATQTQFFHVKVLNTSLKEKFNGKKIIIISDYLEY
DSLLEVNEESTVSEAGPNQTFEVPNKIINRAKE
BLAST against CATH

[top]
Domain History Events (11)

Domain assigned by auto on 21 Feb 2008 16:02

Assigning to "2.40.50.140" based on similarity with "2oq0A01"

Flow stage update by auto on 21 Feb 2008 15:49

No in_process hits for Domain "2oq0C01" ready to be processed

Update comment by auto on 21 Feb 2008 15:36

Domain "2oq0C01" hits Domain "2oq0A01" (97.3451327433628% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 20:10

Domain "2oq0C01" hits Domain "2oq0D01" (97.3451327433628% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2oq0C01" hits Domain "2oq0D01" (97.3451327433628% over 100%) which is currently in process

Update comment by auto on 31 Aug 2007 19:49

Domain "2oq0C01" hits Domain "2oq0D01" (97.3451327433628% over 100%) which is currently in process

Flow stage update by auto on 31 Aug 2007 19:48

Domain "2oq0C01" hits Domain "2oq0D01" (97.3451327433628% over 100%) which is currently in process

Flow stage update by auto on 31 Aug 2007 19:48

NW result present for Domain "2oq0C01"

Flow stage update by auto on 24 Aug 2007 10:06

All required files are present for Domain "2oq0C01"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2oq0C01"

Insertion by auto on 23 Aug 2007 14:09

Final ChopClose added based on similarity with "2oq0D"