CATH Domain: 2oplB01 XML data for domain: 2oplB01

Molscript image for 2oplB01
2oplB01
PDB coordinates for domain 2oplB01

PDB 2opl, Chain B, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.300 GMP Synthetase; Chain A, domain 3
3.30.300.20 Gene3D
3.30.300.20.15
3.30.300.20.15.1
3.30.300.20.15.1.1
3.30.300.20.15.1.1.1
3.30.300.20.15.1.1.1.1

[top]
Segment boundaries for domain 2oplB01

Chopping figure for domain 2oplB01
DomainStart PDB ResidueStop PDB Residue
2oplB01 5 174

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2oplB01
TVVNGVNVDQLATIEQIKAKPEIAQFKFRATNQWGGTHNQATIKDFYGACAEDDTRKPVFDLDEPPVLLGENRGANPVEY
LLVALSGCLTTSLVAHAAARGIALRGVKSRYEGDIDLRGFLGLSEEVPVGYREIRVFFSIDADLTDGQKEELIRAQKYSP
VYNTVA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2oplB01
GXSQTTVVNGVNVDQLXATIEQIKAKPEIAQFKFRATNQWXGGTHNQATIKDFYGACAEDDTRKPXVFDLDEPPVLLGEN
RGANPVEYLLVALSGCLTTSLVAHAAARGIALRGVKSRYEGDIDLRGFLGLSEEVPVGYREIRVFFSIDADLTDGQKEEL
IRXAQKYSPVYNTVA
BLAST against CATH

[top]
Domain History Events (10)

Domain assigned by auto on 21 Feb 2008 15:35

Assigning to "3.30.300.20" based on similarity with "2oplA01"

Flow stage update by auto on 21 Feb 2008 15:22

No in_process hits for Domain "2oplB01" ready to be processed

Update comment by auto on 03 Sep 2007 20:10

Domain "2oplB01" hits Domain "2oplA01" (96.5714285714286% over 99.4318181818182%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2oplB01" hits Domain "2oplA01" (96.5714285714286% over 99.4318181818182%) which is currently in process

Update comment by auto on 31 Aug 2007 19:49

Domain "2oplB01" hits Domain "2oplA01" (96.5714285714286% over 99.4318181818182%) which is currently in process

Flow stage update by auto on 31 Aug 2007 19:48

Domain "2oplB01" hits Domain "2oplA01" (96.5714285714286% over 99.4318181818182%) which is currently in process

Flow stage update by auto on 31 Aug 2007 19:48

NW result present for Domain "2oplB01"

Flow stage update by auto on 24 Aug 2007 10:05

All required files are present for Domain "2oplB01"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2oplB01"

Insertion by auto on 23 Aug 2007 14:09

Final ChopClose added based on similarity with "2oplA"