Domain assigned by cuff on 02 Apr 2008 14:08
i agree. same superfamily
CATH Domain: 2opiB00
2opiB00
PDB 2opi, Chain B, Domain 0
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|2opiB00 ITDEHIELFLAQAHRYGDAKLLCSSGNLSWRIGEEALISGTGSWVPTLAKEKVSICNIASGTPTNGVKPSESTFHLGVLR ERPDVNVVLHFQSEYATAISCKNKPTNFNVTAEIPCHVGSEIPVIPYYRPGSPELAKAVVEALKHNSVLLTNHGQVVCGK DFDQVYERATFFEACRIIVQSGGDYSVLTPEEIEDLEIYVLGK
Domain History Events (58)
Homcheck review by rupa on 12 Sep 2007 14:30
Very high ssap score, same fold and pfam class.
Flow stage update by rupa on 12 Sep 2007 14:30
Very high ssap score, same fold and pfam class.
Domain assignment manual match h by rupa on 12 Sep 2007 14:30
Very high ssap score, same fold and pfam class.
Homcheck allotment by rupa on 12 Sep 2007 14:28
User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by rupa on 12 Sep 2007 14:28
User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 12 Sep 2007 07:42
Domain "2opiB00" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 12 Sep 2007 07:41
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2opiB00
Flow stage update by auto on 12 Sep 2007 07:33
Retrieved PRC_PFAMCATH results for job ID SID9186334102401120 and results inserted.
Domain scan prc pfamcath by auto on 12 Sep 2007 07:32
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 8 results for 2opiB00
Update comment by auto on 12 Sep 2007 03:17
PRC_PFAMCATH job SID9186334102401120 is not yet finished.
Flow stage update by auto on 12 Sep 2007 03:13
The entry "2opiB00" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 12 Sep 2007 03:13
The entry "2opiB00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 12 Sep 2007 02:31
Retrieved SSAP results for job ID SID9261938286880624 and results inserted.
Domain scan ssap cath by auto on 12 Sep 2007 02:30
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 192 results for 2opiB00
Update comment by auto on 09 Sep 2007 23:05
SSAP job SID9261938286880624 is not yet finished.
Ssap cath submit by auto on 09 Sep 2007 22:21
The entry "2opiB00" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 22:21
The entry "2opiB00" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 19:54
Giving up on SSAP job SID4484432473333088 because submission time of Wed Sep 5 16:12:45 2007 is more than 345600 seconds older than current time (Sun Sep 9 19:54:17 2007).
Update comment by auto on 05 Sep 2007 19:39
SSAP job SID4484432473333088 is not yet finished.
Ssap cath submit by auto on 05 Sep 2007 16:12
The entry "2opiB00" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 16:12
The entry "2opiB00" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 09:40
Retrieved PRC results for job ID SID4114948041655008 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 09:39
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 6 results for 2opiB00
Flow stage update by auto on 05 Sep 2007 03:48
The entry "2opiB00" has been submitted to the PRC webservice.
Prc cath submit by auto on 05 Sep 2007 03:48
The entry "2opiB00" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Sep 2007 22:35
Retrieved HMM(SAM) results for job ID SID5641462852030624 and inserted them into the database.
Domain scan sam cath by auto on 04 Sep 2007 22:34
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 6 results for 2opiB00
Update comment by auto on 04 Sep 2007 12:11
HMM(SAM) job SID5641462852030624 is not yet finished.
Flow stage update by auto on 04 Sep 2007 10:01
The entry "2opiB00" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 04 Sep 2007 10:01
The entry "2opiB00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 02:29
Retrieved "2opiB00" CATHEDRAL results for job ID SID2353433979788032 and inserted them into the database.
Domain scan cathedral cath by auto on 04 Sep 2007 02:28
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 507 results for 2opiB00
Cathedral cath submit by auto on 03 Sep 2007 14:06
The entry "2opiB00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 14:06
The entry "2opiB00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 12:07
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2opiB00.scanlist" for "2opiB00"
Write scan list by auto on 03 Sep 2007 12:07
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2opiB00.scanlist" for domain "2opiB00"
Update comment by auto on 03 Sep 2007 10:10
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:31
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:36
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:32
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 18:21
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 14:21
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 10:15
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 02:27
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 22:12
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 18:14
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 14:16
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 11:41
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 06:14
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 03:32
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Aug 2007 20:06
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Flow stage update by auto on 31 Aug 2007 20:00
No satisfactory AssignClose result found.
Flow stage update by auto on 31 Aug 2007 19:48
No in_process hits for Domain "2opiB00" ready to be processed
Flow stage update by auto on 31 Aug 2007 19:48
NW result present for Domain "2opiB00"
Flow stage update by auto on 24 Aug 2007 10:05
All required files are present for Domain "2opiB00"
Flow stage update by auto on 23 Aug 2007 18:40
Beginning processing for Domain "2opiB00"
Insertion by cuff on 23 Aug 2007 11:57
nice chopping
