CATH Domain: 2oogD00 XML data for domain: 2oogD00

Molscript image for 2oogD00
2oogD00
PDB coordinates for domain 2oogD00

PDB 2oog, Chain D, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.20 Alpha-Beta Barrel
3.20.20 TIM Barrel
3.20.20.190 Phosphatidylinositol (PI) phosphodiesterase Gene3D
3.20.20.190.8
3.20.20.190.8.1
3.20.20.190.8.1.1
3.20.20.190.8.1.1.1
3.20.20.190.8.1.1.1.1

Segment boundaries for domain 2oogD00

Chopping figure for domain 2oogD00
DomainStart PDB ResidueStop PDB Residue
2oogD00 44 311

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.20.20.190.8.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2otdA01 85.07 Glycerophospholipid metabolismShigella flexneriGlycerophosphoryl diester phosphodiesterase [EC:3.1.4.46]Glycerophosphodiester phosphodiesterase 3.20.20.190 222 27 82 2.11 2.57
2o55A00 83.65 3.20.20.190 247 21 85 2.53 2.95
Displaying entries 1 to 2 (page 1 of 1)


Domain ATOM Sequence

>pdb|2oogD00
QWHTNLTNERFTTIAHRGASGYAPEHTFQAYDKSHNELKASYIEIDLQRTKDGHLVAMHDETVNRTTNGHGKVEDYTLDE
LKQLDAGSWFNKKYPKYARASYKNAKVPTLDEILERYGPNANYYIETKSPDVYPGMEEQLLASLKKHHLLNNNKLKNGHV
MIQSFSDESLKKIHRQNKHVPLVKLVDKGELQQFNDQRLKEIRSYAIGLGPDYTDLTEQNTHHLKDLGFIVHPYTVNEKA
DMLRLNKYGVDGVFTNFADKYKEVIKEG    

Domain COMBS Sequence

>pdb|2oogD00
EQTNQIANKPQAIQWHTNLTNERFTTIAHRGASGYAPEHTFQAYDKSHNELKASYIEIDLQRTKDGHLVAMHDETVNRTT
NGHGKVEDYTLDELKQLDAGSWFNKKYPKYARASYKNAKVPTLDEILERYGPNANYYIETKSPDVYPGMEEQLLASLKKH
HLLNNNKLKNGHVMIQSFSDESLKKIHRQNKHVPLVKLVDKGELQQFNDQRLKEIRSYAIGLGPDYTDLTEQNTHHLKDL
GFIVHPYTVNEKADMLRLNKYGVDGVFTNFADKYKEVIKEGHHHHHH    

Domain History Events (14)

Domain assigned by auto on 14 Feb 2008 18:13

Assigning to "3.20.20.190" based on similarity with "2oogA00"

Flow stage update by auto on 14 Feb 2008 18:11

No in_process hits for Domain "2oogD00" ready to be processed

Update comment by auto on 14 Feb 2008 17:57

Domain "2oogD00" hits Domain "2oogC00" (100% over 100%) which is currently in process

Update comment by auto on 14 Feb 2008 17:43

Domain "2oogD00" hits Domain "2oogE00" (100% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 20:10

Domain "2oogD00" hits Domain "2oogA00" (100% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2oogD00" hits Domain "2oogA00" (100% over 100%) which is currently in process

Update comment by auto on 11 Aug 2007 14:42

Domain "2oogD00" hits Domain "2oogA00" (100% over 100%) which is currently in process

Update comment by auto on 10 Aug 2007 23:26

Domain "2oogD00" hits Domain "2oogA00" (100% over 100%) which is currently in process

Update comment by auto on 03 Aug 2007 02:39

Domain "2oogD00" hits Domain "2oogA00" (100% over 100%) which is currently in process

Flow stage update by auto on 03 Aug 2007 02:37

Domain "2oogD00" hits Domain "2oogA00" (100% over 100%) which is currently in process

Flow stage update by auto on 03 Aug 2007 02:37

NW result present for Domain "2oogD00"

Flow stage update by auto on 12 Jul 2007 02:02

All required files are present for Domain "2oogD00"

Flow stage update by auto on 11 Jul 2007 18:04

Beginning processing for Domain "2oogD00"

Insertion by auto on 11 Jul 2007 18:02

Final ChopClose added based on similarity with "2oogE"