CATH Domain: 2oodA01 XML data for domain: 2oodA01

Molscript image for 2oodA01
2oodA01
PDB coordinates for domain 2oodA01

PDB 2ood, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.30 Roll
2.30.40 Urease, subunit C; domain 1
2.30.40.10 Urease, subunit C, domain 1 Gene3D
2.30.40.10.21
2.30.40.10.21.1
2.30.40.10.21.1.1
2.30.40.10.21.1.1.1
2.30.40.10.21.1.1.1.1

[top]
Segment boundaries for domain 2oodA01

Chopping figure for domain 2oodA01
DomainStart PDB ResidueStop PDB Residue
2oodA01 3 73
2oodA01 397 467
2oodA02 74 396

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 2.30.40.10.21.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1gkrA01 77.17 L-hydantoinaseArthrobacter aurescens 2.30.40.10 87 14 60 2.78 4.63
2imrA01 74.55 Uncharacterized protein DR_0824Deinococcus radiodurans 2.30.40.10 69 13 49 2.36 4.76
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2oodA01
LTTVGIRGTFFDFVDDPWKHIGNEQAAARFHQDGLVVTDGVIKAFGPYEKIAAAHPGVEITHIKDRIIVPNFEPGKEADF
VALDPNGGQLAQPWHQSLIGAGPRTVDEAASLFAVVGDDRCVDETWVGKRLYKKS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2oodA01
XSLTTVGIRGTFFDFVDDPWKHIGNEQAAARFHQDGLXVVTDGVIKAFGPYEKIAAAHPGVEITHIKDRIIVPNFEPGKE
ADFVALDPNGGQLAQPWHQSLIADGAGPRTVDEAASXLFAVXXVGDDRCVDETWVXGKRLYKKSEGHHHHHH
BLAST against CATH

[top]
Domain History Events (59)

Domain assigned by cuff on 21 Feb 2008 16:04

same superfamily

Domain assignment manual match h by cuff on 21 Feb 2008 16:02

similar function and structure. same superfamily in SCOP. nice scores

Domain assignment manual match a by tronnberg on 12 Sep 2007 14:37

SSAP: 80.46 OV: 60 SEQ: 23. Similar linkage. Some structual differnce which makes me think that the query should not be assigned to the same topology as the match (I am not sure). None of the matches in the Scan List with a CATH code and a SSAP score above 70 share the same function with the query.

Homcheck review by tronnberg on 12 Sep 2007 14:37

SSAP: 80.46 OV: 60 SEQ: 23. Similar linkage. Some structual differnce which makes me think that the query should not be assigned to the same topology as the match (I am not sure). None of the matches in the Scan List with a CATH code and a SSAP score above 70 share the same function with the query.

Flow stage update by tronnberg on 12 Sep 2007 14:37

SSAP: 80.46 OV: 60 SEQ: 23. Similar linkage. Some structual differnce which makes me think that the query should not be assigned to the same topology as the match (I am not sure). None of the matches in the Scan List with a CATH code and a SSAP score above 70 share the same function with the query.

Homcheck allotment by tronnberg on 12 Sep 2007 14:20

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 12 Sep 2007 14:20

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 11 Sep 2007 20:18

Domain "2oodA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 11 Sep 2007 20:17

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2oodA01

Flow stage update by auto on 11 Sep 2007 19:45

Retrieved PRC_PFAMCATH results for job ID SID7304826350889856 and results inserted.

Domain scan prc pfamcath by auto on 11 Sep 2007 19:44

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 32 results for 2oodA01

Update comment by auto on 11 Sep 2007 16:02

PRC_PFAMCATH job SID7304826350889856 is not yet finished.

Prc pfamcath submit by auto on 11 Sep 2007 15:53

The entry "2oodA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 11 Sep 2007 15:53

The entry "2oodA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 11 Sep 2007 15:13

Retrieved SSAP results for job ID SID5904246004155216 and results inserted.

Domain scan ssap cath by auto on 11 Sep 2007 15:12

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 307 results for 2oodA01

Update comment by auto on 09 Sep 2007 23:04

SSAP job SID5904246004155216 is not yet finished.

Ssap cath submit by auto on 09 Sep 2007 22:20

The entry "2oodA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 22:20

The entry "2oodA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 19:53

Giving up on SSAP job SID3566526761640864 because submission time of Wed Sep 5 16:12:22 2007 is more than 345600 seconds older than current time (Sun Sep 9 19:53:57 2007).

Update comment by auto on 05 Sep 2007 19:38

SSAP job SID3566526761640864 is not yet finished.

Flow stage update by auto on 05 Sep 2007 16:12

The entry "2oodA01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 05 Sep 2007 16:12

The entry "2oodA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 09:36

Retrieved PRC results for job ID SID0830942415290144 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 09:35

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 14 results for 2oodA01

Flow stage update by auto on 05 Sep 2007 03:48

The entry "2oodA01" has been submitted to the PRC webservice.

Prc cath submit by auto on 05 Sep 2007 03:48

The entry "2oodA01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 22:32

Retrieved HMM(SAM) results for job ID SID0873690878531056 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 22:31

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 3 results for 2oodA01

Update comment by auto on 04 Sep 2007 12:10

HMM(SAM) job SID0873690878531056 is not yet finished.

Sam cath submit by auto on 04 Sep 2007 10:01

The entry "2oodA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 10:01

The entry "2oodA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 02:25

Retrieved "2oodA01" CATHEDRAL results for job ID SID5722887583329152 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 02:24

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 233 results for 2oodA01

Flow stage update by auto on 03 Sep 2007 14:06

The entry "2oodA01" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 03 Sep 2007 14:06

The entry "2oodA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:07

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2oodA01.scanlist" for "2oodA01"

Write scan list by auto on 03 Sep 2007 12:07

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2oodA01.scanlist" for domain "2oodA01"

Update comment by auto on 03 Sep 2007 10:10

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:31

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:36

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:32

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:21

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:21

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:15

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:27

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:12

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:14

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:16

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:41

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:14

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:32

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:06

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 31 Aug 2007 20:00

No satisfactory AssignClose result found.

Flow stage update by auto on 31 Aug 2007 19:48

No in_process hits for Domain "2oodA01" ready to be processed

Flow stage update by auto on 31 Aug 2007 19:48

NW result present for Domain "2oodA01"

Flow stage update by auto on 24 Aug 2007 10:05

All required files are present for Domain "2oodA01"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2oodA01"

Insertion by cuff on 23 Aug 2007 11:57

nice chopping