CATH Domain: 2oo6A01 XML data for domain: 2oo6A01

Molscript image for 2oo6A01
2oo6A01
PDB coordinates for domain 2oo6A01

PDB 2oo6, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.390 Enolase-like; domain 1
3.30.390.10 Enolase-like, N-terminal domain Gene3D
3.30.390.10.18
3.30.390.10.18.1
3.30.390.10.18.1.1
3.30.390.10.18.1.1.1
3.30.390.10.18.1.1.1.2

[top]
Segment boundaries for domain 2oo6A01

Chopping figure for domain 2oo6A01
DomainStart PDB ResidueStop PDB Residue
2oo6A01 1 102
2oo6A01 375 385
2oo6A02 103 374

Structural Neighbourhood (13 entries)

There are 13 matching structural neighberhood comparisons for CATH ID 3.30.390.10.18.1.1.1.2 (SIMAX score < 5)

[1]
Displaying entries 1 to 13 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3bjsA01 89.25 Polaromonas sp. JS666Mandelate racemase/muconate lactonizing enzyme 3.30.390.10 116 18 87 1.91 2.17
2ovlA01 88.31 Toluene and xylene degradationStreptomyces coelicolorMandelate racemase [EC:5.1.2.2]Benzoate degradation via hydroxylationPutative racemase 3.30.390.10 123 18 86 1.82 2.09
2qq6B01 88.29 Rubrobacter xylanophilus DSM 9941Mandelate racemase/muconate lactonizing enzyme-like protein 3.30.390.10 115 20 91 2.21 2.42
1nu5A01 88.27 Chloromuconate cycloisomerasePseudomonas sp. P51 3.30.390.10 116 20 81 1.63 1.99
1tkkA01 86.82 Bacillus subtilisL-Ala-D/L-Glu epimerase 3.30.390.10 115 21 83 1.97 2.36
1tzzB01 85.96 Bradyrhizobium japonicumBll6730 protein 3.30.390.10 119 21 84 2.51 2.96
2oqyA01 84.13 Muconate cycloisomeraseOceanobacillus iheyensis 3.30.390.10 142 20 79 2.57 3.23
1jpdX01 83.94 Racemase and epimerase activity, acting on amino acids and derivativesL-Ala-D/L-Glu epimeraseEscherichia coli K-12 3.30.390.10 99 18 77 2.44 3.16
2pgwA01 83.38 Sinorhizobium melilotiToluene and xylene degradationBenzoate degradation via hydroxylationMuconate cycloisomerase [EC:5.5.1.1]Mandelate racemase/muconate lactonizing enzyme family protein 3.30.390.10 147 18 75 2.20 2.91
2hzgB01 83.17 Rhodobacter sphaeroides 2.4.1Mandelate racemase/muconate lactonizing enzyme/Enolase superfamily 3.30.390.10 143 18 73 2.12 2.89
2nqlA01 83.05 Agrobacterium tumefaciens str. C58Isomerase/lactonizing enzyme 3.30.390.10 162 23 69 2.00 2.89
2oz8A01 80.58 Mesorhizobium lotiMll7089 protein 3.30.390.10 128 15 77 3.24 4.19
1stzA03 76.53 Thermotoga maritimaHeat-inducible transcription repressor hrcAHeat-inducible transcriptional repressor 3.30.390.60 89 19 75 3.23 4.28
[1]
Displaying entries 1 to 13 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2oo6A01
LKVVSVDTLCCDAGWRNYHFVKLTTDEGIVGWSEFDEGFGSPGVTAVIEQLGKRLVGASVMEHERFFAEAYCLTRPATGG
VVSEGIGAIENALLDAKAKTLNTDPVEEAILAH
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2oo6A01
MSLKVVSVDTLCCDAGWRNYHFVKLTTDEGIVGWSEFDEGFGSPGVTAVIEQLGKRLVGASVMEHERFFAEAYCLTRPAT
GGVVSEGIGAIENALLDAKAKTLNTDPVEEAILAH
BLAST against CATH

[top]
Domain History Events (57)

Domain assigned by cuff on 21 Feb 2008 15:11

same superfamily

Domain assignment manual match h by tronnberg on 12 Sep 2007 14:19

SSAP: 83.98 OV: 77 SEQ: 18. Similar linkage and structure. Functionally similar, both are l-alanine-dl-glutamate epimerases.

Homcheck review by tronnberg on 12 Sep 2007 14:19

SSAP: 83.98 OV: 77 SEQ: 18. Similar linkage and structure. Functionally similar, both are l-alanine-dl-glutamate epimerases.

Flow stage update by tronnberg on 12 Sep 2007 14:19

SSAP: 83.98 OV: 77 SEQ: 18. Similar linkage and structure. Functionally similar, both are l-alanine-dl-glutamate epimerases.

Homcheck allotment by tronnberg on 12 Sep 2007 14:12

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 12 Sep 2007 14:12

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 11 Sep 2007 20:17

Domain "2oo6A01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 11 Sep 2007 20:16

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2oo6A01

Flow stage update by auto on 11 Sep 2007 19:44

Retrieved PRC_PFAMCATH results for job ID SID0417431208459056 and results inserted.

Domain scan prc pfamcath by auto on 11 Sep 2007 19:43

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 32 results for 2oo6A01

Update comment by auto on 11 Sep 2007 16:01

PRC_PFAMCATH job SID0417431208459056 is not yet finished.

Flow stage update by auto on 11 Sep 2007 15:52

The entry "2oo6A01" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 11 Sep 2007 15:52

The entry "2oo6A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 11 Sep 2007 15:11

Retrieved SSAP results for job ID SID0913400044700312 and results inserted.

Domain scan ssap cath by auto on 11 Sep 2007 15:08

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 3209 results for 2oo6A01

Update comment by auto on 09 Sep 2007 23:04

SSAP job SID0913400044700312 is not yet finished.

Ssap cath submit by auto on 09 Sep 2007 22:20

The entry "2oo6A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 22:20

The entry "2oo6A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 19:53

Giving up on SSAP job SID6260834524596128 because submission time of Wed Sep 5 16:11:58 2007 is more than 345600 seconds older than current time (Sun Sep 9 19:53:38 2007).

Update comment by auto on 05 Sep 2007 19:38

SSAP job SID6260834524596128 is not yet finished.

Ssap cath submit by auto on 05 Sep 2007 16:11

The entry "2oo6A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 16:11

The entry "2oo6A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 09:33

Retrieved PRC results for job ID SID7831988330862976 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 09:32

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 30 results for 2oo6A01

Prc cath submit by auto on 04 Sep 2007 13:48

The entry "2oo6A01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 13:48

The entry "2oo6A01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 12:10

Retrieved HMM(SAM) results for job ID SID3138438001789302 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 12:09

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 20 results for 2oo6A01

Sam cath submit by auto on 04 Sep 2007 10:01

The entry "2oo6A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 10:01

The entry "2oo6A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 02:21

Retrieved "2oo6A01" CATHEDRAL results for job ID SID1032111386693000 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 02:20

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 34 results for 2oo6A01

Cathedral cath submit by auto on 03 Sep 2007 14:06

The entry "2oo6A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 14:06

The entry "2oo6A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:06

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2oo6A01.scanlist" for "2oo6A01"

Write scan list by auto on 03 Sep 2007 12:06

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2oo6A01.scanlist" for domain "2oo6A01"

Update comment by auto on 03 Sep 2007 10:10

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:31

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:36

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:32

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:21

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:21

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:15

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:27

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:12

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:14

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:16

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:41

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:14

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:31

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:06

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 31 Aug 2007 19:59

No satisfactory AssignClose result found.

Flow stage update by auto on 31 Aug 2007 19:48

No in_process hits for Domain "2oo6A01" ready to be processed

Flow stage update by auto on 31 Aug 2007 19:48

NW result present for Domain "2oo6A01"

Flow stage update by auto on 24 Aug 2007 10:05

All required files are present for Domain "2oo6A01"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2oo6A01"

Insertion by cuff on 23 Aug 2007 11:57

nice chopping