Domain assigned by auto on 16 Mar 2009 16:43
Assigning to "3.40.190.10" based on similarity with "2onkE01"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2onsA01 | 29 | 112 |
| 2onsA01 | 284 | 342 |
| 2onsA02 | 113 | 283 |
There are 17 matching structural neighberhood comparisons for CATH ID 3.40.190.10.10.1.1.1.1 (SIMAX score < 5)
>pdb|2onsA01 GHMNVKLKVFHAGSLTEPMKAFKRAFEEKHPNVEVQTEAAGSAATIRKVTELGRKADVIATADYTLIQKMMYPEFANWTI MFAKVYGITIPKNAENRELAVEFVKLVISEEGQEILRELGQEPLVPPRADTAVPSLKAMVEVS
Assigning to "3.40.190.10" based on similarity with "2onkE01"
No in_process hits for Domain "2onsA01" ready to be processed
Domain "2onsA01" hits Domain "2onkE01" (100% over 100%) which is currently in process
Domain "2onsA01" hits Domain "2onkE01" (100% over 100%) which is currently in process
NW result present for Domain "2onsA01"
All required files are present for Domain "2onsA01"
Beginning processing for Domain "2onsA01"
fine