CATH Domain: 2onfA01 XML data for domain: 2onfA01

Molscript image for 2onfA01
2onfA01
PDB coordinates for domain 2onfA01

PDB 2onf, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.300 GMP Synthetase; Chain A, domain 3
3.30.300.20 Gene3D
3.30.300.20.9
3.30.300.20.9.1
3.30.300.20.9.1.1
3.30.300.20.9.1.1.1
3.30.300.20.9.1.1.1.1

[top]
Segment boundaries for domain 2onfA01

Chopping figure for domain 2onfA01
DomainStart PDB ResidueStop PDB Residue
2onfA01 6 139

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 3.30.300.20.9.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2d7vB00 83.78 Vibrio choleraePutative uncharacterized protein 3.30.300.20 151 16 79 1.97 2.48
1lqlA02 83.36 Mycoplasma pneumoniaeUncharacterized protein MG427 homolog 3.30.300.20 103 17 72 1.84 2.54
2pn2A00 83.32 Psychrobacter arcticus 273-4Putative uncharacterized protein 3.30.300.20 129 17 89 2.22 2.49
2oplB01 79.02 Geobacter sulfurreducensPutative uncharacterized protein 3.30.300.20 154 15 70 2.59 3.66
1ukkA00 78.44 Osmotically inducible protein CThermus thermophilus 3.30.300.20 136 18 88 3.36 3.81
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2onfA01
SDVSWIDDRRTEVSVGDHRIEVDSPPEFGGPEGQLYPETLFPSVLASCLLTTFLEFKDRGINLKSWNSHVTAELGPSPEK
GFKFHRIKIHVKIGVNDEDKEKIPRAQLAEKYCFISRAIRNNVEEIVDYEFV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2onfA01
SDVSWIDDRRTEVSVGDHRIEVDSPPEFGGPEGQLYPETLFPSVLASCLLTTFLEFKDRXGINLKSWNSHVTAELGPSPE
KGFKFHRIKIHVKIGVNDEDKEKIPRAXQLAEKYCFISRAIRNNVEEIVDYEFV
BLAST against CATH

[top]
Domain History Events (113)

Domain assigned by cuff on 09 Mar 2008 11:43

same superfamily

Domain assignment manual match h by cuff on 09 Mar 2008 11:40

ample evidence for homology

Domain assignment manual match t by tronnberg on 06 Sep 2007 11:16

SSAP: 78.44 OV: 88 SEQ: 18. Similar structure and linkage. I believe that 2d7vA00 (TBA) should be assign to the same topology.

Homcheck review by tronnberg on 06 Sep 2007 11:16

SSAP: 78.44 OV: 88 SEQ: 18. Similar structure and linkage. I believe that 2d7vA00 (TBA) should be assign to the same topology.

Flow stage update by tronnberg on 06 Sep 2007 11:16

SSAP: 78.44 OV: 88 SEQ: 18. Similar structure and linkage. I believe that 2d7vA00 (TBA) should be assign to the same topology.

Domain assignment manual match t by tronnberg on 03 Sep 2007 13:39

SSAP: 83.43 OV: 78 SEQ: 17. Similar linkage.

Homcheck allotment by tronnberg on 03 Sep 2007 12:30

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 03 Sep 2007 12:30

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 02 Sep 2007 15:29

Domain "2onfA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 02 Sep 2007 15:29

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2onfA01

Flow stage update by auto on 02 Sep 2007 15:04

Retrieved PRC_PFAMCATH results for job ID SID2433480717772704 and results inserted.

Domain scan prc pfamcath by auto on 02 Sep 2007 15:04

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 5 results for 2onfA01

Update comment by auto on 02 Sep 2007 11:31

PRC_PFAMCATH job SID2433480717772704 is not yet finished.

Prc pfamcath submit by auto on 02 Sep 2007 11:27

The entry "2onfA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 02 Sep 2007 11:27

The entry "2onfA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 02 Sep 2007 10:45

Retrieved SSAP results for job ID SID1071838583103688 and results inserted.

Domain scan ssap cath by auto on 02 Sep 2007 10:44

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 930 results for 2onfA01

Update comment by auto on 31 Aug 2007 20:24

SSAP job SID1071838583103688 is not yet finished.

Ssap cath submit by auto on 31 Aug 2007 20:15

The entry "2onfA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 31 Aug 2007 20:15

The entry "2onfA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 30 Aug 2007 16:54

Giving up on SSAP job SID6890565218634936 because submission time of Tue Aug 28 14:57:59 2007 is more than 172800 seconds older than current time (Thu Aug 30 16:54:36 2007).

Update comment by auto on 28 Aug 2007 15:04

SSAP job SID6890565218634936 is not yet finished.

Ssap cath submit by auto on 28 Aug 2007 14:57

The entry "2onfA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Aug 2007 14:57

The entry "2onfA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Aug 2007 10:23

Giving up on SSAP job SID4273590729378800 because submission time of Sun Aug 26 09:17:04 2007 is more than 172800 seconds older than current time (Tue Aug 28 10:23:39 2007).

Update comment by auto on 26 Aug 2007 09:25

SSAP job SID4273590729378800 is not yet finished.

Ssap cath submit by auto on 26 Aug 2007 09:17

The entry "2onfA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 26 Aug 2007 09:17

The entry "2onfA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 26 Aug 2007 03:01

Giving up on SSAP job SID3089820028490144 because submission time of Thu Aug 23 22:39:10 2007 is more than 172800 seconds older than current time (Sun Aug 26 03:01:41 2007).

Update comment by auto on 23 Aug 2007 22:48

SSAP job SID3089820028490144 is not yet finished.

Ssap cath submit by auto on 23 Aug 2007 22:39

The entry "2onfA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Aug 2007 22:39

The entry "2onfA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Aug 2007 19:41

Giving up on SSAP job SID3039936891362616 because submission time of Tue Aug 21 11:01:10 2007 is more than 172800 seconds older than current time (Thu Aug 23 19:41:42 2007).

Update comment by auto on 21 Aug 2007 11:41

SSAP job SID3039936891362616 is not yet finished.

Ssap cath submit by auto on 21 Aug 2007 11:01

The entry "2onfA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 21 Aug 2007 11:01

The entry "2onfA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 21 Aug 2007 08:23

Giving up on SSAP job SID3838170081827592 because submission time of Sun Aug 19 07:41:27 2007 is more than 172800 seconds older than current time (Tue Aug 21 08:23:03 2007).

Update comment by auto on 19 Aug 2007 08:33

SSAP job SID3838170081827592 is not yet finished.

Ssap cath submit by auto on 19 Aug 2007 07:41

The entry "2onfA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 19 Aug 2007 07:41

The entry "2onfA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 19 Aug 2007 03:41

Giving up on SSAP job SID4555703255189184 because submission time of Thu Aug 16 23:32:28 2007 is more than 172800 seconds older than current time (Sun Aug 19 03:41:17 2007).

Update comment by auto on 17 Aug 2007 00:41

SSAP job SID4555703255189184 is not yet finished.

Ssap cath submit by auto on 16 Aug 2007 23:32

The entry "2onfA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 23:32

The entry "2onfA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 18:41

Giving up on SSAP job SID2204872010226656 because submission time of Tue Aug 14 09:16:52 2007 is more than 172800 seconds older than current time (Thu Aug 16 18:41:52 2007).

Update comment by auto on 14 Aug 2007 10:43

SSAP job SID2204872010226656 is not yet finished.

Ssap cath submit by auto on 14 Aug 2007 09:16

The entry "2onfA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 09:16

The entry "2onfA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 07:29

Retrieved PRC results for job ID SID4289500609381776 and inserted them into the database.

Domain scan prc cath by auto on 14 Aug 2007 07:29

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 6 results for 2onfA01

Flow stage update by auto on 13 Aug 2007 10:52

The entry "2onfA01" has been submitted to the PRC webservice.

Prc cath submit by auto on 13 Aug 2007 10:52

The entry "2onfA01" has been submitted to the PRC webservice.

Flow stage update by auto on 13 Aug 2007 09:01

Retrieved HMM(SAM) results for job ID SID5599263352744560 and inserted them into the database.

Domain scan sam cath by auto on 13 Aug 2007 09:01

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 4 results for 2onfA01

Update comment by auto on 12 Aug 2007 13:16

HMM(SAM) job SID5599263352744560 is not yet finished.

Sam cath submit by auto on 12 Aug 2007 12:02

The entry "2onfA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 12:02

The entry "2onfA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 05:32

Retrieved "2onfA01" CATHEDRAL results for job ID SID9972068424119712 and inserted them into the database.

Domain scan cathedral cath by auto on 12 Aug 2007 05:31

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 181 results for 2onfA01

Update comment by auto on 11 Aug 2007 06:05

"2onfA01" CATHEDRAL job SID9972068424119712 is not yet finished.

Cathedral cath submit by auto on 11 Aug 2007 04:36

The entry "2onfA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 11 Aug 2007 04:36

The entry "2onfA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 11 Aug 2007 02:45

ScanList with 9778 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2onfA01.scanlist" for "2onfA01"

Write scan list by auto on 11 Aug 2007 02:44

Writing ScanList containing 9778 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2onfA01.scanlist" for domain "2onfA01"

Update comment by auto on 10 Aug 2007 14:33

Waiting for 984 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 10:32

Waiting for 1052 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 06:46

Waiting for 1095 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 02:48

Waiting for 1146 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 22:33

Waiting for 1198 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 19:15

Waiting for 1261 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 14:59

Waiting for 1336 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 10:59

Waiting for 1377 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 06:45

Waiting for 1412 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 02:52

Waiting for 1457 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 22:36

Waiting for 1505 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 18:44

Waiting for 1577 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 14:43

Waiting for 1645 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 11:06

Waiting for 1704 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 06:52

Waiting for 1742 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 02:59

Waiting for 1792 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 22:47

Waiting for 1837 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 19:34

Waiting for 1893 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 15:16

Waiting for 1975 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 10:45

Waiting for 2056 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 06:58

Waiting for 2116 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 02:51

Waiting for 2178 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 22:38

Waiting for 2230 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 18:51

Waiting for 2293 new domains (example : 1t6pD03) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 14:45

Waiting for 2348 new domains (example : 1rqrB02) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 11:23

Waiting for 2404 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 09:19

Waiting for 2415 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 02:17

Waiting for 2528 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 19:06

Waiting for 2652 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 07:24

Waiting for 2828 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 03:15

Waiting for 2883 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 22:52

Waiting for 2924 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 19:09

Waiting for 2965 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 15:12

Waiting for 3034 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 11:12

Waiting for 3098 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 07:01

Waiting for 3152 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 03:11

Waiting for 3197 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 22:58

Waiting for 3216 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 19:55

Waiting for 3206 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 15:51

Waiting for 3198 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 11:03

Waiting for 3055 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 07:05

Waiting for 3126 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 03:04

Waiting for 3204 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Flow stage update by auto on 03 Aug 2007 02:39

No satisfactory AssignClose result found.

Flow stage update by auto on 03 Aug 2007 02:37

No in_process hits for Domain "2onfA01" ready to be processed

Flow stage update by auto on 03 Aug 2007 02:37

NW result present for Domain "2onfA01"

Flow stage update by auto on 12 Jul 2007 02:02

All required files are present for Domain "2onfA01"

Flow stage update by auto on 11 Jul 2007 16:04

Beginning processing for Domain "2onfA01"

Insertion by cuff on 11 Jul 2007 14:57

nice chopping