Domain assigned by cuff on 21 Feb 2008 17:01
same superfamily
CATH Domain: 2olsA04
2olsA04
PDB 2ols, Chain A, Domain 4
Segment boundaries for domain 2olsA04
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2olsA01 | 4 | 195 |
| 2olsA02 | 196 | 360 |
| 2olsA03 | 361 | 376 |
| 2olsA03 | 391 | 480 |
| 2olsA04 | 481 | 792 |
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|2olsA04 PKAPVKVMMNVGNPELAFSFANLPSEGIGLARMEFIINRQIGIHPKALLEFDKQDDELKAEITRRIAGYASPVDFYVDKI AEGVATLAASVYPRKTIVRMSDFKSNEYANLVGGNVYEPHEENPMLGFRGAARYVADNFKDCFALECKALKRVRDEMGLT NVEIMIPFVRTLGEAEAVVKALKENGLERGKNGLRLIMMCELPSNAVLAEQFLQYFDGFSIGSNDMTQLTLGLDRDSGLV SESFDERNPAVKVMLHLAISACRKQNKYVGICGQGPSDHPDFAKWLVEEGIESVSLNPDTVIETWLYLANEL
Domain COMBS Sequence
>pdb|2olsA04 PKAPVKVMMNVGNPELAFSFANLPSEGIGLARMEFIINRQIGIHPKALLEFDKQDDELKAEITRRIAGYASPVDFYVDKI AEGVATLAASVYPRKTIVRMSDFKSNEYANLVGGNVYEPHEENPMLGFRGAARYVADNFKDCFALECKALKRVRDEMGLT NVEIMIPFVRTLGEAEAVVKALKENGLERGKNGLRLIMMCELPSNAVLAEQFLQYFDGFSIGSNDMTQLTLGLDRDSGLV SESFDERNPAVKVMLHLAISACRKQNKYVGICGQGPSDHPDFAKWLVEEGIESVSLNPDTVIETWLYLANELNK
Domain History Events (58)
Domain assignment manual match h by cuff on 21 Feb 2008 17:00
brilliant scores
Domain assignment manual match t by tronnberg on 17 Sep 2007 10:14
SSAP: 82.8 OV: 84 SEQ: 23. Reasonable similar structure and linkage. Functionally different. None of the matches on the scan list with a SSAP score above 70 has the exact the same function as the query.
Homcheck review by tronnberg on 17 Sep 2007 10:14
SSAP: 82.8 OV: 84 SEQ: 23. Reasonable similar structure and linkage. Functionally different. None of the matches on the scan list with a SSAP score above 70 has the exact the same function as the query.
Flow stage update by tronnberg on 17 Sep 2007 10:14
SSAP: 82.8 OV: 84 SEQ: 23. Reasonable similar structure and linkage. Functionally different. None of the matches on the scan list with a SSAP score above 70 has the exact the same function as the query.
Homcheck allotment by tronnberg on 17 Sep 2007 10:06
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by tronnberg on 17 Sep 2007 10:06
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 15 Sep 2007 18:39
Domain "2olsA04" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 15 Sep 2007 18:38
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2olsA04
Flow stage update by auto on 15 Sep 2007 14:45
Retrieved PRC_PFAMCATH results for job ID SID9699763415703624 and results inserted.
Domain scan prc pfamcath by auto on 15 Sep 2007 14:44
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 13 results for 2olsA04
Update comment by auto on 15 Sep 2007 09:03
PRC_PFAMCATH job SID9699763415703624 is not yet finished.
Flow stage update by auto on 15 Sep 2007 08:34
The entry "2olsA04" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 15 Sep 2007 08:34
The entry "2olsA04" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 14 Sep 2007 22:30
Retrieved SSAP results for job ID SID8945703575604680 and results inserted.
Domain scan ssap cath by auto on 14 Sep 2007 22:29
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 369 results for 2olsA04
Update comment by auto on 09 Sep 2007 23:04
SSAP job SID8945703575604680 is not yet finished.
Ssap cath submit by auto on 09 Sep 2007 22:20
The entry "2olsA04" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 22:20
The entry "2olsA04" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 19:53
Giving up on SSAP job SID9907873099868608 because submission time of Wed Sep 5 16:11:42 2007 is more than 345600 seconds older than current time (Sun Sep 9 19:53:25 2007).
Update comment by auto on 05 Sep 2007 19:38
SSAP job SID9907873099868608 is not yet finished.
Ssap cath submit by auto on 05 Sep 2007 16:11
The entry "2olsA04" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 16:11
The entry "2olsA04" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 09:31
Retrieved PRC results for job ID SID2761565482039648 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 09:30
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 6 results for 2olsA04
Flow stage update by auto on 04 Sep 2007 13:48
The entry "2olsA04" has been submitted to the PRC webservice.
Prc cath submit by auto on 04 Sep 2007 13:48
The entry "2olsA04" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Sep 2007 12:08
Retrieved HMM(SAM) results for job ID SID3847447498712160 and inserted them into the database.
Domain scan sam cath by auto on 04 Sep 2007 12:07
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 5 results for 2olsA04
Sam cath submit by auto on 04 Sep 2007 10:00
The entry "2olsA04" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 10:00
The entry "2olsA04" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 02:19
Retrieved "2olsA04" CATHEDRAL results for job ID SID6630023400960928 and inserted them into the database.
Domain scan cathedral cath by auto on 04 Sep 2007 02:18
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 129 results for 2olsA04
Cathedral cath submit by auto on 03 Sep 2007 14:05
The entry "2olsA04" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 14:05
The entry "2olsA04" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 12:06
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2olsA04.scanlist" for "2olsA04"
Write scan list by auto on 03 Sep 2007 12:06
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2olsA04.scanlist" for domain "2olsA04"
Update comment by auto on 03 Sep 2007 10:10
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:31
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:36
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:32
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 18:21
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 14:21
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 10:15
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 02:27
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 22:12
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 18:14
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 14:16
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 11:41
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 06:14
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 03:31
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Aug 2007 20:06
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Flow stage update by auto on 31 Aug 2007 19:59
No satisfactory AssignClose result found.
Flow stage update by auto on 31 Aug 2007 19:48
No in_process hits for Domain "2olsA04" ready to be processed
Flow stage update by auto on 31 Aug 2007 19:48
NW result present for Domain "2olsA04"
Flow stage update by auto on 24 Aug 2007 10:05
All required files are present for Domain "2olsA04"
Flow stage update by auto on 23 Aug 2007 18:40
Beginning processing for Domain "2olsA04"
Insertion by cuff on 23 Aug 2007 11:57
nice chopping
