Domain assigned by cuff on 21 Feb 2008 15:05
same superfamily
CATH Domain: 2olsA02
2olsA02
PDB 2ols, Chain A, Domain 2
Segment boundaries for domain 2olsA02
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2olsA01 | 4 | 195 |
| 2olsA02 | 196 | 360 |
| 2olsA03 | 361 | 376 |
| 2olsA03 | 391 | 480 |
| 2olsA04 | 481 | 792 |
Structural Neighbourhood (1 entries)
There are 1 matching structural neighberhood comparisons for CATH ID 3.30.470.20.13.1.1.1.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 1 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
 |
1kblA06 | 80.87 | 3.30.470.20 | 98 | 24 | 65 | 2.48 | 3.81 |
[1]
Displaying entries 1 to 1 (page 1 of 1)
Domain ATOM Sequence
>pdb|2olsA02 SDSGASGVMFTLDTESGYDQVVFVTSSYGLGENVVQGAVNPDEFYVFKPTLKAGKPAILRKTMGSKHIKMIFTDKAEAGK SVTNVDVPEEDRNRFSITDEEITELAHYALTIEKHYGRPMDIEWGRDGLDGKLYILQARPETL
Domain History Events (57)
Domain assignment manual match h by rupa on 12 Sep 2007 13:17
Very high ssap score, same fold and high sequence similarity.
Homcheck review by rupa on 12 Sep 2007 13:17
Very high ssap score, same fold and high sequence similarity.
Flow stage update by rupa on 12 Sep 2007 13:17
Very high ssap score, same fold and high sequence similarity.
Homcheck allotment by rupa on 12 Sep 2007 13:16
User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by rupa on 12 Sep 2007 13:16
User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 11 Sep 2007 20:15
Domain "2olsA02" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 11 Sep 2007 20:14
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2olsA02
Flow stage update by auto on 11 Sep 2007 19:42
Retrieved PRC_PFAMCATH results for job ID SID6039893406079440 and results inserted.
Domain scan prc pfamcath by auto on 11 Sep 2007 19:41
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 5 results for 2olsA02
Update comment by auto on 11 Sep 2007 16:01
PRC_PFAMCATH job SID6039893406079440 is not yet finished.
Flow stage update by auto on 11 Sep 2007 15:52
The entry "2olsA02" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 11 Sep 2007 15:52
The entry "2olsA02" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 11 Sep 2007 15:07
Retrieved SSAP results for job ID SID8456594366724032 and results inserted.
Domain scan ssap cath by auto on 11 Sep 2007 15:05
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1395 results for 2olsA02
Update comment by auto on 09 Sep 2007 23:04
SSAP job SID8456594366724032 is not yet finished.
Ssap cath submit by auto on 09 Sep 2007 22:20
The entry "2olsA02" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 22:20
The entry "2olsA02" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 19:53
Giving up on SSAP job SID7095654953095520 because submission time of Wed Sep 5 16:11:27 2007 is more than 345600 seconds older than current time (Sun Sep 9 19:53:12 2007).
Update comment by auto on 05 Sep 2007 19:38
SSAP job SID7095654953095520 is not yet finished.
Ssap cath submit by auto on 05 Sep 2007 16:11
The entry "2olsA02" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 16:11
The entry "2olsA02" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 09:29
Retrieved PRC results for job ID SID9038635785816640 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 09:28
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 2 results for 2olsA02
Flow stage update by auto on 04 Sep 2007 13:48
The entry "2olsA02" has been submitted to the PRC webservice.
Prc cath submit by auto on 04 Sep 2007 13:48
The entry "2olsA02" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Sep 2007 12:06
Retrieved HMM(SAM) results for job ID SID2028894218760992 and inserted them into the database.
Domain scan sam cath by auto on 04 Sep 2007 12:05
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 2olsA02
Flow stage update by auto on 04 Sep 2007 10:00
The entry "2olsA02" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 04 Sep 2007 10:00
The entry "2olsA02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 02:16
Retrieved "2olsA02" CATHEDRAL results for job ID SID0721975682624800 and inserted them into the database.
Domain scan cathedral cath by auto on 04 Sep 2007 02:15
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 339 results for 2olsA02
Cathedral cath submit by auto on 03 Sep 2007 14:05
The entry "2olsA02" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 14:05
The entry "2olsA02" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 12:06
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2olsA02.scanlist" for "2olsA02"
Write scan list by auto on 03 Sep 2007 12:06
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2olsA02.scanlist" for domain "2olsA02"
Update comment by auto on 03 Sep 2007 10:10
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:31
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:36
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:32
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 18:21
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 14:21
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 10:15
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 02:27
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 22:12
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 18:14
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 14:16
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 11:41
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 06:14
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 03:31
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Aug 2007 20:06
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Flow stage update by auto on 31 Aug 2007 19:59
No satisfactory AssignClose result found.
Flow stage update by auto on 31 Aug 2007 19:48
No in_process hits for Domain "2olsA02" ready to be processed
Flow stage update by auto on 31 Aug 2007 19:48
NW result present for Domain "2olsA02"
Flow stage update by auto on 24 Aug 2007 10:05
All required files are present for Domain "2olsA02"
Flow stage update by auto on 23 Aug 2007 18:40
Beginning processing for Domain "2olsA02"
Insertion by cuff on 23 Aug 2007 11:57
nice chopping
