CATH Domain: 2okuA00 XML data for domain: 2okuA00

Molscript image for 2okuA00
2okuA00
PDB coordinates for domain 2okuA00

PDB 2oku, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.120 Four Helix Bundle (Hemerythrin (Met), subunit A)
1.20.120.470 PG0775 C-terminal domain-like Gene3D
1.20.120.470.1
1.20.120.470.1.1
1.20.120.470.1.1.1
1.20.120.470.1.1.1.1
1.20.120.470.1.1.1.1.1

[top]
Segment boundaries for domain 2okuA00

Chopping figure for domain 2okuA00
DomainStart PDB ResidueStop PDB Residue
2okuA00 443 564

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 1.20.120.470.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3dwwA00 76.19 Arachidonic acid metabolismProstaglandin metabolic processHomo sapiensProstaglandin E synthaseProstaglandin-E synthase [EC:5.3.99.3] 1.20.120.550 142 4 66 2.86 4.32
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2okuA00
QVVAAIRHITTGTYIARIREEYQQTEVKPELQPKEALARTDRAEALIAFVTEQKDQELLDFQARRLVETAHAVFGHLLLA
ANDDDSFRQSAEVYLRYGQAEQEKIDSYVRAFRPEELT
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2okuA00
QVVAAIRHITTGTYIARIREEYQQTEVKPELQPXKEALARXTDRAEALIAFVTEQKDQELLDFQARRLVEXTAHAVFGHL
LXLAANDDDSFRQSAEVYLRYGQAEQEKIDSYVRAFRPEELTFYSRCSRPE
BLAST against CATH

[top]
Domain History Events (113)

Domain assigned by cuff on 09 Mar 2008 10:37

not enough functional evidence for homology but same fold.

Domain assignment manual match t by rupa on 03 Sep 2007 12:26

Good ssap and cathedral scores same fold. Different function.

Homcheck review by rupa on 03 Sep 2007 12:26

Good ssap and cathedral scores same fold. Different function.

Flow stage update by rupa on 03 Sep 2007 12:26

Good ssap and cathedral scores same fold. Different function.

Homcheck allotment by rupa on 03 Sep 2007 12:23

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by rupa on 03 Sep 2007 12:23

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 02 Sep 2007 15:29

Domain "2okuA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 02 Sep 2007 15:28

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2okuA00

Flow stage update by auto on 02 Sep 2007 15:04

Retrieved PRC_PFAMCATH results for job ID SID5946514105722432 and results inserted.

Domain scan prc pfamcath by auto on 02 Sep 2007 15:03

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2okuA00

Update comment by auto on 02 Sep 2007 11:31

PRC_PFAMCATH job SID5946514105722432 is not yet finished.

Prc pfamcath submit by auto on 02 Sep 2007 11:27

The entry "2okuA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 02 Sep 2007 11:27

The entry "2okuA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 02 Sep 2007 10:44

Retrieved SSAP results for job ID SID2844651925260304 and results inserted.

Domain scan ssap cath by auto on 02 Sep 2007 10:42

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2039 results for 2okuA00

Update comment by auto on 31 Aug 2007 20:23

SSAP job SID2844651925260304 is not yet finished.

Ssap cath submit by auto on 31 Aug 2007 20:15

The entry "2okuA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 31 Aug 2007 20:15

The entry "2okuA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 30 Aug 2007 16:54

Giving up on SSAP job SID1084803828992336 because submission time of Tue Aug 28 14:57:53 2007 is more than 172800 seconds older than current time (Thu Aug 30 16:54:29 2007).

Update comment by auto on 28 Aug 2007 15:04

SSAP job SID1084803828992336 is not yet finished.

Ssap cath submit by auto on 28 Aug 2007 14:57

The entry "2okuA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Aug 2007 14:57

The entry "2okuA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Aug 2007 10:23

Giving up on SSAP job SID6345775397875904 because submission time of Sun Aug 26 09:16:57 2007 is more than 172800 seconds older than current time (Tue Aug 28 10:23:31 2007).

Update comment by auto on 26 Aug 2007 09:25

SSAP job SID6345775397875904 is not yet finished.

Ssap cath submit by auto on 26 Aug 2007 09:16

The entry "2okuA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 26 Aug 2007 09:16

The entry "2okuA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 26 Aug 2007 03:01

Giving up on SSAP job SID4071266974412608 because submission time of Thu Aug 23 22:39:04 2007 is more than 172800 seconds older than current time (Sun Aug 26 03:01:33 2007).

Update comment by auto on 23 Aug 2007 22:48

SSAP job SID4071266974412608 is not yet finished.

Ssap cath submit by auto on 23 Aug 2007 22:39

The entry "2okuA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Aug 2007 22:39

The entry "2okuA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Aug 2007 19:41

Giving up on SSAP job SID6031153908805872 because submission time of Tue Aug 21 11:00:55 2007 is more than 172800 seconds older than current time (Thu Aug 23 19:41:36 2007).

Update comment by auto on 21 Aug 2007 11:41

SSAP job SID6031153908805872 is not yet finished.

Flow stage update by auto on 21 Aug 2007 11:00

The entry "2okuA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 21 Aug 2007 11:00

The entry "2okuA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 21 Aug 2007 08:22

Giving up on SSAP job SID5363605955912928 because submission time of Sun Aug 19 07:41:10 2007 is more than 172800 seconds older than current time (Tue Aug 21 08:22:45 2007).

Update comment by auto on 19 Aug 2007 08:32

SSAP job SID5363605955912928 is not yet finished.

Ssap cath submit by auto on 19 Aug 2007 07:41

The entry "2okuA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 19 Aug 2007 07:41

The entry "2okuA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 19 Aug 2007 03:41

Giving up on SSAP job SID9591951350560784 because submission time of Thu Aug 16 23:32:13 2007 is more than 172800 seconds older than current time (Sun Aug 19 03:41:02 2007).

Update comment by auto on 17 Aug 2007 00:41

SSAP job SID9591951350560784 is not yet finished.

Ssap cath submit by auto on 16 Aug 2007 23:32

The entry "2okuA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 23:32

The entry "2okuA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 18:41

Giving up on SSAP job SID0476910232689856 because submission time of Tue Aug 14 09:16:25 2007 is more than 172800 seconds older than current time (Thu Aug 16 18:41:32 2007).

Update comment by auto on 14 Aug 2007 10:42

SSAP job SID0476910232689856 is not yet finished.

Ssap cath submit by auto on 14 Aug 2007 09:16

The entry "2okuA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 09:16

The entry "2okuA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 07:26

Retrieved PRC results for job ID SID3739910403543584 and inserted them into the database.

Domain scan prc cath by auto on 14 Aug 2007 07:25

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2okuA00

Prc cath submit by auto on 13 Aug 2007 22:25

The entry "2okuA00" has been submitted to the PRC webservice.

Flow stage update by auto on 13 Aug 2007 22:25

The entry "2okuA00" has been submitted to the PRC webservice.

Flow stage update by auto on 13 Aug 2007 22:18

Retrieved HMM(SAM) results for job ID SID3109224980053084 and inserted them into the database.

Domain scan sam cath by auto on 13 Aug 2007 22:17

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2okuA00

Update comment by auto on 12 Aug 2007 13:15

HMM(SAM) job SID3109224980053084 is not yet finished.

Sam cath submit by auto on 12 Aug 2007 12:02

The entry "2okuA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 12:02

The entry "2okuA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 05:29

Retrieved "2okuA00" CATHEDRAL results for job ID SID4014277158672832 and inserted them into the database.

Domain scan cathedral cath by auto on 12 Aug 2007 05:28

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 156 results for 2okuA00

Update comment by auto on 11 Aug 2007 06:04

"2okuA00" CATHEDRAL job SID4014277158672832 is not yet finished.

Flow stage update by auto on 11 Aug 2007 04:35

The entry "2okuA00" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 11 Aug 2007 04:35

The entry "2okuA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 11 Aug 2007 02:44

ScanList with 9778 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2okuA00.scanlist" for "2okuA00"

Write scan list by auto on 11 Aug 2007 02:43

Writing ScanList containing 9778 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2okuA00.scanlist" for domain "2okuA00"

Update comment by auto on 10 Aug 2007 14:33

Waiting for 984 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 10:32

Waiting for 1052 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 06:46

Waiting for 1095 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 02:47

Waiting for 1146 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 22:33

Waiting for 1198 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 19:15

Waiting for 1261 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 14:59

Waiting for 1336 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 10:59

Waiting for 1377 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 06:45

Waiting for 1412 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 02:52

Waiting for 1457 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 22:36

Waiting for 1505 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 18:44

Waiting for 1577 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 14:43

Waiting for 1645 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 11:06

Waiting for 1704 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 06:52

Waiting for 1742 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 02:58

Waiting for 1792 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 22:47

Waiting for 1837 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 19:34

Waiting for 1893 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 15:16

Waiting for 1975 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 10:45

Waiting for 2056 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 06:58

Waiting for 2116 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 02:51

Waiting for 2178 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 22:38

Waiting for 2230 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 18:51

Waiting for 2293 new domains (example : 1t6pD03) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 14:45

Waiting for 2348 new domains (example : 1rqrB02) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 11:23

Waiting for 2404 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 09:19

Waiting for 2415 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 02:17

Waiting for 2528 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 19:06

Waiting for 2652 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 07:24

Waiting for 2828 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 03:15

Waiting for 2883 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 22:52

Waiting for 2924 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 19:08

Waiting for 2965 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 15:12

Waiting for 3034 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 11:12

Waiting for 3098 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 07:01

Waiting for 3152 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 03:11

Waiting for 3197 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 22:58

Waiting for 3216 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 19:54

Waiting for 3206 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 15:51

Waiting for 3198 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 11:03

Waiting for 3055 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 07:05

Waiting for 3126 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 03:03

Waiting for 3204 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 22:48

Waiting for 3254 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 19:33

Waiting for 3282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Flow stage update by auto on 02 Aug 2007 19:06

No satisfactory AssignClose result found.

Flow stage update by auto on 02 Aug 2007 19:02

No in_process hits for Domain "2okuA00" ready to be processed

Flow stage update by auto on 02 Aug 2007 19:02

NW result present for Domain "2okuA00"

Flow stage update by auto on 12 Jul 2007 02:02

All required files are present for Domain "2okuA00"

Flow stage update by auto on 11 Jul 2007 16:04

Beginning processing for Domain "2okuA00"

Insertion by cuff on 11 Jul 2007 14:57

nice chopping