CATH Domain: 2oktA02 XML data for domain: 2oktA02

Molscript image for 2oktA02
2oktA02
PDB coordinates for domain 2oktA02

PDB 2okt, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.20 Alpha-Beta Barrel
3.20.20 TIM Barrel
3.20.20.120 Enolase superfamily Gene3D
3.20.20.120.6
3.20.20.120.6.1
3.20.20.120.6.1.1
3.20.20.120.6.1.1.1
3.20.20.120.6.1.1.1.1

Segment boundaries for domain 2oktA02

Chopping figure for domain 2oktA02
DomainStart PDB ResidueStop PDB Residue
2oktA01 0 115
2oktA01 322 333
2oktA02 116 321

Structural Neighbourhood (32 entries)

There are 32 matching structural neighberhood comparisons for CATH ID 3.20.20.120.6.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 32 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1jpdX02 81.84 Racemase and epimerase activity, acting on amino acids and derivativesL-Ala-D/L-Glu epimeraseEscherichia coli K-12 3.20.20.120 207 18 90 2.74 3.02
2chrA02 81.09 Ralstonia eutropha JMP134Chloromuconate cycloisomeraseToluene and xylene degradationMuconate cycloisomerase [EC:5.5.1.1]Benzoate degradation via hydroxylation 3.20.20.120 202 15 84 2.72 3.21
1r6wA01 80.41 Ubiquinone and other terpenoid-quinone biosynthesisMetabolic pathwaysMenaquinone biosynthetic processO-succinylbenzoate synthaseHydro-lyase activity 3.20.20.120 198 17 86 3.40 3.94
2pgwA02 80.24 Sinorhizobium melilotiToluene and xylene degradationBenzoate degradation via hydroxylationMuconate cycloisomerase [EC:5.5.1.1]Mandelate racemase/muconate lactonizing enzyme family protein 3.20.20.120 215 19 86 2.95 3.39
2nqlA02 79.25 Agrobacterium tumefaciens str. C58Isomerase/lactonizing enzyme 3.20.20.120 214 14 87 3.24 3.69
2oztA02 78.88 Ubiquinone and other terpenoid-quinone biosynthesisThermosynechococcus elongatus BP-1O-succinylbenzoate synthase [EC:4.2.1.113]Tlr1174 proteinMetabolic pathways 3.20.20.120 201 16 86 3.29 3.80
2zadA02 78.57 Thermotoga maritimaL-Ala-D/L-Glu epimerase 3.20.20.120 222 16 82 2.97 3.60
2qvhA02 78.49 Ubiquinone and other terpenoid-quinone biosynthesisThermobifida fusca YXO-succinylbenzoate-CoA synthaseO-succinylbenzoate synthase [EC:4.2.1.113]Metabolic pathways 3.20.20.120 224 17 82 3.20 3.87
1tkkA02 78.24 Bacillus subtilisL-Ala-D/L-Glu epimerase 3.20.20.120 244 14 77 2.88 3.72
3cawA02 78.21 Ubiquinone and other terpenoid-quinone biosynthesisO-succinylbenzoate synthase [EC:4.2.1.113]Bdellovibrio bacteriovorusMetabolic pathwaysPutative uncharacterized protein 3.20.20.120 225 15 82 3.53 4.29
1mdlA02 77.44 Mandelate racemasePseudomonas putida 3.20.20.120 230 14 78 2.87 3.65
2pmqA02 77.27 Roseovarius sp. HTCC2601Mandelate racemase/muconate lactonizing enzyme 3.20.20.120 224 15 81 3.14 3.84
2oqhA02 77.13 Putative isomeraseStreptomyces coelicolor 3.20.20.120 240 15 77 2.81 3.65
2oqyA02 77.10 Muconate cycloisomeraseOceanobacillus iheyensis 3.20.20.120 226 14 83 3.31 3.98
2qdeA02 77.04 Aromatoleum aromaticum EbN1Mandelate racemase/muconate lactonizing enzyme family protein 3.20.20.120 239 20 78 3.10 3.94
2qgyA02 76.93 3.20.20.120 231 15 81 3.01 3.70
2qddA02 76.75 Mandelate racemase/muconate lactonizing enzyme, putativeRoseovarius nubinhibens ISM 3.20.20.120 236 15 78 3.14 4.01
3fv9A02 76.72 Mandelate racemase/muconate lactonizing enzyme, putativeRoseovarius nubinhibens ISM 3.20.20.120 243 14 77 2.98 3.85
2pozH02 76.36 Putative dehydrataseMesorhizobium loti 3.20.20.120 246 13 74 3.10 4.14
2oz8A02 76.27 Mesorhizobium lotiMll7089 protein 3.20.20.120 230 14 77 3.16 4.06
3bjsA02 76.25 Polaromonas sp. JS666Mandelate racemase/muconate lactonizing enzyme 3.20.20.120 250 19 75 3.13 4.14
3cb3A02 75.87 Toluene and xylene degradationPolaromonas sp. JS666Mandelate racemase [EC:5.1.2.2]Mandelate racemase/muconate lactonizing enzymeBenzoate degradation via hydroxylation 3.20.20.120 233 16 78 3.41 4.37
1yeyB02 75.31 Xanthomonas campestris pv. campestrisRTS beta protein 3.20.20.120 243 15 75 3.32 4.41
2ovlA02 74.90 Toluene and xylene degradationStreptomyces coelicolorMandelate racemase [EC:5.1.2.2]Benzoate degradation via hydroxylationPutative racemase 3.20.20.120 223 15 78 3.12 3.98
1ec7A02 74.71 Ascorbate and aldarate metabolismD-glucarate catabolic processGlucarate dehydratase activityGlucarate dehydrataseGlucarate dehydratase [EC:4.2.1.40] 3.20.20.120 261 12 72 3.04 4.20
3go2A02 74.24 Burkholderia xenovorans LB400Putative uncharacterized protein 3.20.20.120 268 13 69 3.20 4.59
2podB02 74.16 Mandelate racemase / muconate lactonizing enzymeBurkholderia pseudomallei 3.20.20.120 251 12 74 3.26 4.40
2hzgA02 73.93 Rhodobacter sphaeroides 2.4.1Mandelate racemase/muconate lactonizing enzyme/Enolase superfamily 3.20.20.120 248 15 74 3.46 4.64
2qq6A02 73.66 Rubrobacter xylanophilus DSM 9941Mandelate racemase/muconate lactonizing enzyme-like protein 3.20.20.120 262 14 69 3.25 4.65
1rvkA02 73.22 Agrobacterium tumefaciens str. C58Isomerase/lactonizing enzyme 3.20.20.120 255 13 69 3.23 4.63
1tzzA02 72.86 Bradyrhizobium japonicumBll6730 protein 3.20.20.120 256 16 70 3.37 4.77
3cyjA02 72.80 Rubrobacter xylanophilus DSM 9941Mandelate racemase/muconate lactonizing enzyme-like proteinToluene and xylene degradationMandelate racemase [EC:5.1.2.2]Benzoate degradation via hydroxylation 3.20.20.120 235 16 79 3.62 4.55
Displaying entries 1 to 32 (page 1 of 1)


Domain ATOM Sequence

>pdb|2oktA02
SFSVAYGATASGLSNKQLESLKATKPTRIKLKWTPQIMHQIRVLRELDFHFQLVIDANESLDRQDFTQLQLLAREQVLYI
EEPFKDISMLDEVADGTIPPIALDEKATSLLDIINLIELYNVKVVVLKPFRLGGIDKVQTAIDTLKSHGAKVVIGGMYEY
GLSRYFTAMLARKGDYPGDVTPAGYYFEQDVVAHSGILKEGRLEFR    

Domain COMBS Sequence

>pdb|2oktA02
SFSVAYGATASGLSNKQLESLKATKPTRIKLKWTPQIMHQIRVLRELDFHFQLVIDANESLDRQDFTQLQLLAREQVLYI
EEPFKDISMLDEVADGTIPPIALDEKATSLLDIINLIELYNVKVVVLKPFRLGGIDKVQTAIDTLKSHGAKVVIGGMYEY
GLSRYFTAMLARKGDYPGDVTPAGYYFEQDVVAHSGILKEGRLEFR    

Domain History Events (113)

Domain assigned by cuff on 14 Feb 2008 17:17

same superfamily in SCOP

Domain scan prc pfamcath by auto on 25 Sep 2007 13:24

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 70 results for 2oktA02

Domain assignment manual match h by rupa on 03 Sep 2007 12:23

Very high ssap score, same fold, different function.

Homcheck review by rupa on 03 Sep 2007 12:23

Very high ssap score, same fold, different function.

Flow stage update by rupa on 03 Sep 2007 12:23

Very high ssap score, same fold, different function.

Homcheck allotment by rupa on 03 Sep 2007 12:21

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by rupa on 03 Sep 2007 12:21

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 02 Sep 2007 15:27

Domain "2oktA02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 02 Sep 2007 15:27

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2oktA02

Flow stage update by auto on 02 Sep 2007 15:02

Retrieved PRC_PFAMCATH results for job ID SID5177811134946176 and results inserted.

Update comment by auto on 02 Sep 2007 11:31

PRC_PFAMCATH job SID5177811134946176 is not yet finished.

Prc pfamcath submit by auto on 02 Sep 2007 11:27

The entry "2oktA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 02 Sep 2007 11:27

The entry "2oktA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 02 Sep 2007 10:40

Retrieved SSAP results for job ID SID2269173452859616 and results inserted.

Domain scan ssap cath by auto on 02 Sep 2007 10:38

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 804 results for 2oktA02

Update comment by auto on 31 Aug 2007 20:23

SSAP job SID2269173452859616 is not yet finished.

Ssap cath submit by auto on 31 Aug 2007 20:15

The entry "2oktA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 31 Aug 2007 20:15

The entry "2oktA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 30 Aug 2007 16:54

Giving up on SSAP job SID6716363946841664 because submission time of Tue Aug 28 14:57:41 2007 is more than 172800 seconds older than current time (Thu Aug 30 16:54:15 2007).

Update comment by auto on 28 Aug 2007 15:04

SSAP job SID6716363946841664 is not yet finished.

Ssap cath submit by auto on 28 Aug 2007 14:57

The entry "2oktA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Aug 2007 14:57

The entry "2oktA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Aug 2007 10:23

Giving up on SSAP job SID5319220275933984 because submission time of Sun Aug 26 09:16:41 2007 is more than 172800 seconds older than current time (Tue Aug 28 10:23:17 2007).

Update comment by auto on 26 Aug 2007 09:25

SSAP job SID5319220275933984 is not yet finished.

Ssap cath submit by auto on 26 Aug 2007 09:16

The entry "2oktA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 26 Aug 2007 09:16

The entry "2oktA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 26 Aug 2007 03:01

Giving up on SSAP job SID8661309989801072 because submission time of Thu Aug 23 22:38:51 2007 is more than 172800 seconds older than current time (Sun Aug 26 03:01:18 2007).

Update comment by auto on 23 Aug 2007 22:48

SSAP job SID8661309989801072 is not yet finished.

Flow stage update by auto on 23 Aug 2007 22:38

The entry "2oktA02" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 23 Aug 2007 22:38

The entry "2oktA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Aug 2007 19:41

Giving up on SSAP job SID5853044116993680 because submission time of Tue Aug 21 11:00:42 2007 is more than 172800 seconds older than current time (Thu Aug 23 19:41:23 2007).

Update comment by auto on 21 Aug 2007 11:40

SSAP job SID5853044116993680 is not yet finished.

Flow stage update by auto on 21 Aug 2007 11:00

The entry "2oktA02" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 21 Aug 2007 11:00

The entry "2oktA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 21 Aug 2007 08:22

Giving up on SSAP job SID5695808106479488 because submission time of Sun Aug 19 07:40:53 2007 is more than 172800 seconds older than current time (Tue Aug 21 08:22:30 2007).

Update comment by auto on 19 Aug 2007 08:32

SSAP job SID5695808106479488 is not yet finished.

Ssap cath submit by auto on 19 Aug 2007 07:40

The entry "2oktA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 19 Aug 2007 07:40

The entry "2oktA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 19 Aug 2007 03:40

Giving up on SSAP job SID7499037203041152 because submission time of Thu Aug 16 23:31:58 2007 is more than 172800 seconds older than current time (Sun Aug 19 03:40:47 2007).

Update comment by auto on 17 Aug 2007 00:41

SSAP job SID7499037203041152 is not yet finished.

Ssap cath submit by auto on 16 Aug 2007 23:31

The entry "2oktA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 23:31

The entry "2oktA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 18:41

Giving up on SSAP job SID7992429493594176 because submission time of Tue Aug 14 09:16:02 2007 is more than 172800 seconds older than current time (Thu Aug 16 18:41:12 2007).

Update comment by auto on 14 Aug 2007 10:42

SSAP job SID7992429493594176 is not yet finished.

Ssap cath submit by auto on 14 Aug 2007 09:16

The entry "2oktA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 09:16

The entry "2oktA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 07:23

Retrieved PRC results for job ID SID4896014122660768 and inserted them into the database.

Domain scan prc cath by auto on 14 Aug 2007 07:23

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 21 results for 2oktA02

Prc cath submit by auto on 13 Aug 2007 22:25

The entry "2oktA02" has been submitted to the PRC webservice.

Flow stage update by auto on 13 Aug 2007 22:25

The entry "2oktA02" has been submitted to the PRC webservice.

Flow stage update by auto on 13 Aug 2007 22:17

Retrieved HMM(SAM) results for job ID SID4509002868617768 and inserted them into the database.

Domain scan sam cath by auto on 13 Aug 2007 22:16

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 20 results for 2oktA02

Update comment by auto on 12 Aug 2007 13:15

HMM(SAM) job SID4509002868617768 is not yet finished.

Flow stage update by auto on 12 Aug 2007 12:02

The entry "2oktA02" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 12 Aug 2007 12:02

The entry "2oktA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 05:28

Retrieved "2oktA02" CATHEDRAL results for job ID SID8966352759636894 and inserted them into the database.

Domain scan cathedral cath by auto on 12 Aug 2007 05:27

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 129 results for 2oktA02

Update comment by auto on 11 Aug 2007 06:04

"2oktA02" CATHEDRAL job SID8966352759636894 is not yet finished.

Cathedral cath submit by auto on 11 Aug 2007 04:35

The entry "2oktA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 11 Aug 2007 04:35

The entry "2oktA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 11 Aug 2007 02:43

ScanList with 9778 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2oktA02.scanlist" for "2oktA02"

Write scan list by auto on 11 Aug 2007 02:43

Writing ScanList containing 9778 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2oktA02.scanlist" for domain "2oktA02"

Update comment by auto on 10 Aug 2007 14:33

Waiting for 984 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 10:32

Waiting for 1052 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 06:46

Waiting for 1095 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 02:47

Waiting for 1146 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 22:33

Waiting for 1198 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 19:15

Waiting for 1261 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 14:59

Waiting for 1336 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 10:59

Waiting for 1377 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 06:45

Waiting for 1412 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 02:52

Waiting for 1457 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 22:36

Waiting for 1505 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 18:44

Waiting for 1577 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 14:43

Waiting for 1645 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 11:06

Waiting for 1704 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 06:52

Waiting for 1742 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 02:58

Waiting for 1792 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 22:47

Waiting for 1837 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 19:34

Waiting for 1893 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 15:16

Waiting for 1975 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 10:45

Waiting for 2056 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 06:58

Waiting for 2116 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 02:51

Waiting for 2178 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 22:38

Waiting for 2230 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 18:51

Waiting for 2293 new domains (example : 1t6pD03) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 14:45

Waiting for 2348 new domains (example : 1rqrB02) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 11:23

Waiting for 2404 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 09:19

Waiting for 2415 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 02:17

Waiting for 2528 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 19:06

Waiting for 2652 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 07:24

Waiting for 2828 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 03:15

Waiting for 2883 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 22:52

Waiting for 2924 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 19:08

Waiting for 2965 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 15:12

Waiting for 3034 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 11:12

Waiting for 3098 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 07:01

Waiting for 3152 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 03:11

Waiting for 3197 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 22:58

Waiting for 3216 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 19:54

Waiting for 3206 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 15:51

Waiting for 3198 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 11:03

Waiting for 3055 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 07:05

Waiting for 3126 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 03:03

Waiting for 3204 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 22:48

Waiting for 3254 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 19:33

Waiting for 3282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Flow stage update by auto on 02 Aug 2007 19:06

No satisfactory AssignClose result found.

Flow stage update by auto on 02 Aug 2007 19:02

No in_process hits for Domain "2oktA02" ready to be processed

Flow stage update by auto on 02 Aug 2007 19:02

NW result present for Domain "2oktA02"

Flow stage update by auto on 12 Jul 2007 02:02

All required files are present for Domain "2oktA02"

Flow stage update by auto on 11 Jul 2007 16:04

Beginning processing for Domain "2oktA02"

Insertion by cuff on 11 Jul 2007 14:57

nice chopping