Domain assigned by cuff on 14 Feb 2008 17:17
same superfamily in SCOP
| CATH Code | Level Description | Links |
|---|---|---|
3
| Alpha Beta | |
3.20
| Alpha-Beta Barrel | |
3.20.20
| TIM Barrel | |
3.20.20.120
| Enolase superfamily | Gene3D |
3.20.20.120.6
| ||
3.20.20.120.6.1
| ||
3.20.20.120.6.1.1
| ||
3.20.20.120.6.1.1.1
| ||
3.20.20.120.6.1.1.1.1
|
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2oktA01 | 0 | 115 |
| 2oktA01 | 322 | 333 |
| 2oktA02 | 116 | 321 |
There are 32 matching structural neighberhood comparisons for CATH ID 3.20.20.120.6.1.1.1.1 (SIMAX score < 5)
>pdb|2oktA02 SFSVAYGATASGLSNKQLESLKATKPTRIKLKWTPQIMHQIRVLRELDFHFQLVIDANESLDRQDFTQLQLLAREQVLYI EEPFKDISMLDEVADGTIPPIALDEKATSLLDIINLIELYNVKVVVLKPFRLGGIDKVQTAIDTLKSHGAKVVIGGMYEY GLSRYFTAMLARKGDYPGDVTPAGYYFEQDVVAHSGILKEGRLEFR
same superfamily in SCOP
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 70 results for 2oktA02
Very high ssap score, same fold, different function.
Very high ssap score, same fold, different function.
Very high ssap score, same fold, different function.
User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Domain "2oktA02" SCOP scan with no results - no SCOP mapping
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2oktA02
Retrieved PRC_PFAMCATH results for job ID SID5177811134946176 and results inserted.
PRC_PFAMCATH job SID5177811134946176 is not yet finished.
The entry "2oktA02" has been submitted to the PRC_PFAMCATH webservice.
The entry "2oktA02" has been submitted to the PRC_PFAMCATH webservice.
Retrieved SSAP results for job ID SID2269173452859616 and results inserted.
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 804 results for 2oktA02
SSAP job SID2269173452859616 is not yet finished.
The entry "2oktA02" has been submitted to the SSAP webservice.
The entry "2oktA02" has been submitted to the SSAP webservice.
Giving up on SSAP job SID6716363946841664 because submission time of Tue Aug 28 14:57:41 2007 is more than 172800 seconds older than current time (Thu Aug 30 16:54:15 2007).
SSAP job SID6716363946841664 is not yet finished.
The entry "2oktA02" has been submitted to the SSAP webservice.
The entry "2oktA02" has been submitted to the SSAP webservice.
Giving up on SSAP job SID5319220275933984 because submission time of Sun Aug 26 09:16:41 2007 is more than 172800 seconds older than current time (Tue Aug 28 10:23:17 2007).
SSAP job SID5319220275933984 is not yet finished.
The entry "2oktA02" has been submitted to the SSAP webservice.
The entry "2oktA02" has been submitted to the SSAP webservice.
Giving up on SSAP job SID8661309989801072 because submission time of Thu Aug 23 22:38:51 2007 is more than 172800 seconds older than current time (Sun Aug 26 03:01:18 2007).
SSAP job SID8661309989801072 is not yet finished.
The entry "2oktA02" has been submitted to the SSAP webservice.
The entry "2oktA02" has been submitted to the SSAP webservice.
Giving up on SSAP job SID5853044116993680 because submission time of Tue Aug 21 11:00:42 2007 is more than 172800 seconds older than current time (Thu Aug 23 19:41:23 2007).
SSAP job SID5853044116993680 is not yet finished.
The entry "2oktA02" has been submitted to the SSAP webservice.
The entry "2oktA02" has been submitted to the SSAP webservice.
Giving up on SSAP job SID5695808106479488 because submission time of Sun Aug 19 07:40:53 2007 is more than 172800 seconds older than current time (Tue Aug 21 08:22:30 2007).
SSAP job SID5695808106479488 is not yet finished.
The entry "2oktA02" has been submitted to the SSAP webservice.
The entry "2oktA02" has been submitted to the SSAP webservice.
Giving up on SSAP job SID7499037203041152 because submission time of Thu Aug 16 23:31:58 2007 is more than 172800 seconds older than current time (Sun Aug 19 03:40:47 2007).
SSAP job SID7499037203041152 is not yet finished.
The entry "2oktA02" has been submitted to the SSAP webservice.
The entry "2oktA02" has been submitted to the SSAP webservice.
Giving up on SSAP job SID7992429493594176 because submission time of Tue Aug 14 09:16:02 2007 is more than 172800 seconds older than current time (Thu Aug 16 18:41:12 2007).
SSAP job SID7992429493594176 is not yet finished.
The entry "2oktA02" has been submitted to the SSAP webservice.
The entry "2oktA02" has been submitted to the SSAP webservice.
Retrieved PRC results for job ID SID4896014122660768 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 21 results for 2oktA02
The entry "2oktA02" has been submitted to the PRC webservice.
The entry "2oktA02" has been submitted to the PRC webservice.
Retrieved HMM(SAM) results for job ID SID4509002868617768 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 20 results for 2oktA02
HMM(SAM) job SID4509002868617768 is not yet finished.
The entry "2oktA02" has been submitted to the HMM (SAM) webservice.
The entry "2oktA02" has been submitted to the HMM (SAM) webservice.
Retrieved "2oktA02" CATHEDRAL results for job ID SID8966352759636894 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 129 results for 2oktA02
"2oktA02" CATHEDRAL job SID8966352759636894 is not yet finished.
The entry "2oktA02" has been submitted to the CATHEDRAL webservice.
The entry "2oktA02" has been submitted to the CATHEDRAL webservice.
ScanList with 9778 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2oktA02.scanlist" for "2oktA02"
Writing ScanList containing 9778 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2oktA02.scanlist" for domain "2oktA02"
Waiting for 984 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Waiting for 1052 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Waiting for 1095 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Waiting for 1146 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Waiting for 1198 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Waiting for 1261 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Waiting for 1336 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1377 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1412 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1457 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1505 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1577 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1645 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1704 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1742 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1792 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1837 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1893 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1975 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 2056 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 2116 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 2178 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 2230 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 2293 new domains (example : 1t6pD03) to be processed so that they can be scanned against too.
Waiting for 2348 new domains (example : 1rqrB02) to be processed so that they can be scanned against too.
Waiting for 2404 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 2415 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 2528 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 2652 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 2828 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 2883 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 2924 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 2965 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3034 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3098 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3152 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3197 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3216 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3206 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3198 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3055 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3126 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3204 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3254 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
No satisfactory AssignClose result found.
No in_process hits for Domain "2oktA02" ready to be processed
NW result present for Domain "2oktA02"
All required files are present for Domain "2oktA02"
Beginning processing for Domain "2oktA02"
nice chopping