CATH Domain: 2oktA01 XML data for domain: 2oktA01

Molscript image for 2oktA01
2oktA01
PDB coordinates for domain 2oktA01

PDB 2okt, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.390 Enolase-like; domain 1
3.30.390.10 Enolase-like, N-terminal domain Gene3D
3.30.390.10.1
3.30.390.10.1.1
3.30.390.10.1.1.1
3.30.390.10.1.1.1.1
3.30.390.10.1.1.1.1.1

[top]
Segment boundaries for domain 2oktA01

Chopping figure for domain 2oktA01
DomainStart PDB ResidueStop PDB Residue
2oktA01 0 115
2oktA01 322 333
2oktA02 116 321

Structural Neighbourhood (22 entries)

There are 22 matching structural neighberhood comparisons for CATH ID 3.30.390.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 22 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1tkkA01 86.41 Bacillus subtilisL-Ala-D/L-Glu epimerase 3.30.390.10 115 17 88 2.89 3.25
1nu5A01 86.09 Chloromuconate cycloisomerasePseudomonas sp. P51 3.30.390.10 116 13 89 2.89 3.22
3dgbA01 85.28 Muconate cycloisomeraseToluene and xylene degradationMuconate cycloisomerase [EC:5.5.1.1]Benzoate degradation via hydroxylationMetabolic pathways 3.30.390.10 134 18 88 2.69 3.05
1r0mA01 84.91 Ubiquinone and other terpenoid-quinone biosynthesisN-acylamino acid racemaseO-succinylbenzoate synthase [EC:4.2.1.113]Deinococcus radioduransMetabolic pathways 3.30.390.10 130 18 84 3.03 3.58
2pmqA01 84.84 Roseovarius sp. HTCC2601Mandelate racemase/muconate lactonizing enzyme 3.30.390.10 127 11 92 2.94 3.19
3fv9D01 84.58 Mandelate racemase/muconate lactonizing enzyme, putativeRoseovarius nubinhibens ISM 3.30.390.10 130 13 87 3.33 3.80
2zadA01 84.04 Thermotoga maritimaL-Ala-D/L-Glu epimerase 3.30.390.10 109 10 88 3.48 3.91
1jpdX01 83.34 Racemase and epimerase activity, acting on amino acids and derivativesL-Ala-D/L-Glu epimeraseEscherichia coli K-12 3.30.390.10 99 18 83 3.13 3.73
3go2A01 83.32 Burkholderia xenovorans LB400Putative uncharacterized protein 3.30.390.10 114 14 84 3.31 3.91
3bjsA01 82.89 Polaromonas sp. JS666Mandelate racemase/muconate lactonizing enzyme 3.30.390.10 116 12 83 3.50 4.17
1ec7C01 82.76 Ascorbate and aldarate metabolismD-glucarate catabolic processGlucarate dehydratase activityGlucarate dehydrataseGlucarate dehydratase [EC:4.2.1.40] 3.30.390.10 136 10 78 2.82 3.58
2ovlA01 82.40 Toluene and xylene degradationStreptomyces coelicolorMandelate racemase [EC:5.1.2.2]Benzoate degradation via hydroxylationPutative racemase 3.30.390.10 123 11 88 3.55 4.01
2qq6B01 81.90 Rubrobacter xylanophilus DSM 9941Mandelate racemase/muconate lactonizing enzyme-like protein 3.30.390.10 115 10 80 3.24 4.02
2qgyB01 81.78 3.30.390.10 135 14 80 3.12 3.90
1mdlA01 81.66 Mandelate racemasePseudomonas putida 3.30.390.10 126 16 88 3.82 4.34
2og9A01 81.14 Toluene and xylene degradationPolaromonas sp. JS666Mandelate racemase [EC:5.1.2.2]Mandelate racemase/muconate lactonizing enzymeBenzoate degradation via hydroxylation 3.30.390.10 129 12 80 3.70 4.59
1tzzB01 80.33 Bradyrhizobium japonicumBll6730 protein 3.30.390.10 119 8 77 3.83 4.95
2qjjA01 80.32 Mandelate racemase/muconate lactonizing enzyme, N-terminal domain proteinStarvation sensing protein RspANovosphingobium aromaticivorans DSM 12444 3.30.390.10 140 12 70 2.70 3.82
2pgeA01 79.57 Ubiquinone and other terpenoid-quinone biosynthesisDesulfotalea psychrophilaRelated to N-acylamino acid racemase (MenC)O-succinylbenzoate synthase [EC:4.2.1.113]Metabolic pathways 3.30.390.10 127 14 79 3.50 4.40
2oqyA01 79.47 Muconate cycloisomeraseOceanobacillus iheyensis 3.30.390.10 142 13 75 3.02 4.01
2nqlA01 78.56 Agrobacterium tumefaciens str. C58Isomerase/lactonizing enzyme 3.30.390.10 162 11 67 2.70 3.98
1rvkA01 78.26 Agrobacterium tumefaciens str. C58Isomerase/lactonizing enzyme 3.30.390.10 115 10 83 3.87 4.66
[1]
Displaying entries 1 to 22 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2oktA01
SLKLTALHFYKYSEPFKSQIVTPKVTLTHRDCLFIELIDDKGNAYFGECNAFQTDWYDHETIASVKHVIEQWFEDNRNKS
FETYEAALKLVDSLENTPAARATIVMALYQMFHVLPPPLVDITQLQPY
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2oktA01
SLKLTALHFYKYSEPFKSQIVTPKVTLTHRDCLFIELIDDKGNAYFGECNAFQTDWYDHETIASVKHVIEQWFEDNRNKS
FETYEAALKLVDSLENTPAARATIVMALYQMFHVLPPPLVDITQLQPY
BLAST against CATH

[top]
Domain History Events (113)

Domain assigned by cuff on 14 Feb 2008 17:14

i agree, same superfamily

Domain assignment manual match h by rupa on 03 Sep 2007 12:21

Very high ssap score, same fold. Suggest score high enough for homology.

Homcheck review by rupa on 03 Sep 2007 12:21

Very high ssap score, same fold. Suggest score high enough for homology.

Flow stage update by rupa on 03 Sep 2007 12:21

Very high ssap score, same fold. Suggest score high enough for homology.

Homcheck allotment by rupa on 03 Sep 2007 12:18

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by rupa on 03 Sep 2007 12:18

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 02 Sep 2007 15:28

Domain "2oktA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 02 Sep 2007 15:28

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2oktA01

Flow stage update by auto on 02 Sep 2007 15:03

Retrieved PRC_PFAMCATH results for job ID SID9205606251816640 and results inserted.

Domain scan prc pfamcath by auto on 02 Sep 2007 15:02

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 21 results for 2oktA01

Update comment by auto on 02 Sep 2007 11:31

PRC_PFAMCATH job SID9205606251816640 is not yet finished.

Prc pfamcath submit by auto on 02 Sep 2007 11:27

The entry "2oktA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 02 Sep 2007 11:27

The entry "2oktA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 02 Sep 2007 10:42

Retrieved SSAP results for job ID SID2713733455241664 and results inserted.

Domain scan ssap cath by auto on 02 Sep 2007 10:40

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2061 results for 2oktA01

Update comment by auto on 31 Aug 2007 20:23

SSAP job SID2713733455241664 is not yet finished.

Ssap cath submit by auto on 31 Aug 2007 20:15

The entry "2oktA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 31 Aug 2007 20:15

The entry "2oktA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 30 Aug 2007 16:54

Giving up on SSAP job SID2154503217262800 because submission time of Tue Aug 28 14:57:47 2007 is more than 172800 seconds older than current time (Thu Aug 30 16:54:22 2007).

Update comment by auto on 28 Aug 2007 15:04

SSAP job SID2154503217262800 is not yet finished.

Ssap cath submit by auto on 28 Aug 2007 14:57

The entry "2oktA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Aug 2007 14:57

The entry "2oktA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Aug 2007 10:23

Giving up on SSAP job SID4617563619626832 because submission time of Sun Aug 26 09:16:49 2007 is more than 172800 seconds older than current time (Tue Aug 28 10:23:24 2007).

Update comment by auto on 26 Aug 2007 09:25

SSAP job SID4617563619626832 is not yet finished.

Flow stage update by auto on 26 Aug 2007 09:16

The entry "2oktA01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 26 Aug 2007 09:16

The entry "2oktA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 26 Aug 2007 03:01

Giving up on SSAP job SID1230395093029536 because submission time of Thu Aug 23 22:38:57 2007 is more than 172800 seconds older than current time (Sun Aug 26 03:01:25 2007).

Update comment by auto on 23 Aug 2007 22:48

SSAP job SID1230395093029536 is not yet finished.

Flow stage update by auto on 23 Aug 2007 22:38

The entry "2oktA01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 23 Aug 2007 22:38

The entry "2oktA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Aug 2007 19:41

Giving up on SSAP job SID8907232459204416 because submission time of Tue Aug 21 11:00:49 2007 is more than 172800 seconds older than current time (Thu Aug 23 19:41:29 2007).

Update comment by auto on 21 Aug 2007 11:41

SSAP job SID8907232459204416 is not yet finished.

Ssap cath submit by auto on 21 Aug 2007 11:00

The entry "2oktA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 21 Aug 2007 11:00

The entry "2oktA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 21 Aug 2007 08:22

Giving up on SSAP job SID6867722921607924 because submission time of Sun Aug 19 07:41:02 2007 is more than 172800 seconds older than current time (Tue Aug 21 08:22:37 2007).

Update comment by auto on 19 Aug 2007 08:32

SSAP job SID6867722921607924 is not yet finished.

Ssap cath submit by auto on 19 Aug 2007 07:41

The entry "2oktA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 19 Aug 2007 07:41

The entry "2oktA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 19 Aug 2007 03:40

Giving up on SSAP job SID0024874834410288 because submission time of Thu Aug 16 23:32:06 2007 is more than 172800 seconds older than current time (Sun Aug 19 03:40:55 2007).

Update comment by auto on 17 Aug 2007 00:41

SSAP job SID0024874834410288 is not yet finished.

Ssap cath submit by auto on 16 Aug 2007 23:32

The entry "2oktA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 23:32

The entry "2oktA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 18:41

Giving up on SSAP job SID1204169576941520 because submission time of Tue Aug 14 09:16:17 2007 is more than 172800 seconds older than current time (Thu Aug 16 18:41:21 2007).

Update comment by auto on 14 Aug 2007 10:42

SSAP job SID1204169576941520 is not yet finished.

Flow stage update by auto on 14 Aug 2007 09:16

The entry "2oktA01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 14 Aug 2007 09:16

The entry "2oktA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 07:25

Retrieved PRC results for job ID SID0007548945202384 and inserted them into the database.

Domain scan prc cath by auto on 14 Aug 2007 07:24

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 20 results for 2oktA01

Flow stage update by auto on 13 Aug 2007 10:52

The entry "2oktA01" has been submitted to the PRC webservice.

Prc cath submit by auto on 13 Aug 2007 10:52

The entry "2oktA01" has been submitted to the PRC webservice.

Flow stage update by auto on 13 Aug 2007 09:00

Retrieved HMM(SAM) results for job ID SID7621719896389200 and inserted them into the database.

Domain scan sam cath by auto on 13 Aug 2007 08:59

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 9 results for 2oktA01

Update comment by auto on 12 Aug 2007 13:15

HMM(SAM) job SID7621719896389200 is not yet finished.

Sam cath submit by auto on 12 Aug 2007 12:02

The entry "2oktA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 12:02

The entry "2oktA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 05:27

Retrieved "2oktA01" CATHEDRAL results for job ID SID3393746010596800 and inserted them into the database.

Domain scan cathedral cath by auto on 12 Aug 2007 05:26

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 69 results for 2oktA01

Update comment by auto on 11 Aug 2007 06:04

"2oktA01" CATHEDRAL job SID3393746010596800 is not yet finished.

Flow stage update by auto on 11 Aug 2007 04:35

The entry "2oktA01" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 11 Aug 2007 04:35

The entry "2oktA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 11 Aug 2007 02:43

ScanList with 9778 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2oktA01.scanlist" for "2oktA01"

Write scan list by auto on 11 Aug 2007 02:43

Writing ScanList containing 9778 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2oktA01.scanlist" for domain "2oktA01"

Update comment by auto on 10 Aug 2007 14:33

Waiting for 984 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 10:32

Waiting for 1052 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 06:46

Waiting for 1095 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 02:47

Waiting for 1146 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 22:33

Waiting for 1198 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 19:15

Waiting for 1261 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 14:59

Waiting for 1336 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 10:59

Waiting for 1377 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 06:45

Waiting for 1412 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 02:52

Waiting for 1457 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 22:36

Waiting for 1505 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 18:44

Waiting for 1577 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 14:43

Waiting for 1645 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 11:06

Waiting for 1704 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 06:52

Waiting for 1742 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 02:58

Waiting for 1792 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 22:47

Waiting for 1837 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 19:34

Waiting for 1893 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 15:16

Waiting for 1975 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 10:45

Waiting for 2056 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 06:58

Waiting for 2116 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 02:51

Waiting for 2178 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 22:38

Waiting for 2230 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 18:51

Waiting for 2293 new domains (example : 1t6pD03) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 14:45

Waiting for 2348 new domains (example : 1rqrB02) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 11:23

Waiting for 2404 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 09:19

Waiting for 2415 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 02:17

Waiting for 2528 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 19:06

Waiting for 2652 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 07:24

Waiting for 2828 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 03:15

Waiting for 2883 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 22:52

Waiting for 2924 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 19:08

Waiting for 2965 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 15:12

Waiting for 3034 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 11:12

Waiting for 3098 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 07:01

Waiting for 3152 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 03:11

Waiting for 3197 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 22:58

Waiting for 3216 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 19:54

Waiting for 3206 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 15:51

Waiting for 3198 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 11:03

Waiting for 3055 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 07:05

Waiting for 3126 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 03:03

Waiting for 3204 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 22:48

Waiting for 3254 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 19:33

Waiting for 3282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Flow stage update by auto on 02 Aug 2007 19:06

No satisfactory AssignClose result found.

Flow stage update by auto on 02 Aug 2007 19:02

No in_process hits for Domain "2oktA01" ready to be processed

Flow stage update by auto on 02 Aug 2007 19:02

NW result present for Domain "2oktA01"

Flow stage update by auto on 12 Jul 2007 02:02

All required files are present for Domain "2oktA01"

Flow stage update by auto on 11 Jul 2007 16:04

Beginning processing for Domain "2oktA01"

Insertion by cuff on 11 Jul 2007 14:57

nice chopping