Domain assigned by cuff on 14 Feb 2008 17:14
i agree, same superfamily
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2oktA01 | 0 | 115 |
| 2oktA01 | 322 | 333 |
| 2oktA02 | 116 | 321 |
There are 22 matching structural neighberhood comparisons for CATH ID 3.30.390.10.1.1.1.1.1 (SIMAX score < 5)
>pdb|2oktA01 SLKLTALHFYKYSEPFKSQIVTPKVTLTHRDCLFIELIDDKGNAYFGECNAFQTDWYDHETIASVKHVIEQWFEDNRNKS FETYEAALKLVDSLENTPAARATIVMALYQMFHVLPPPLVDITQLQPY
i agree, same superfamily
Very high ssap score, same fold. Suggest score high enough for homology.
Very high ssap score, same fold. Suggest score high enough for homology.
Very high ssap score, same fold. Suggest score high enough for homology.
User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Domain "2oktA01" SCOP scan with no results - no SCOP mapping
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2oktA01
Retrieved PRC_PFAMCATH results for job ID SID9205606251816640 and results inserted.
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 21 results for 2oktA01
PRC_PFAMCATH job SID9205606251816640 is not yet finished.
The entry "2oktA01" has been submitted to the PRC_PFAMCATH webservice.
The entry "2oktA01" has been submitted to the PRC_PFAMCATH webservice.
Retrieved SSAP results for job ID SID2713733455241664 and results inserted.
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2061 results for 2oktA01
SSAP job SID2713733455241664 is not yet finished.
The entry "2oktA01" has been submitted to the SSAP webservice.
The entry "2oktA01" has been submitted to the SSAP webservice.
Giving up on SSAP job SID2154503217262800 because submission time of Tue Aug 28 14:57:47 2007 is more than 172800 seconds older than current time (Thu Aug 30 16:54:22 2007).
SSAP job SID2154503217262800 is not yet finished.
The entry "2oktA01" has been submitted to the SSAP webservice.
The entry "2oktA01" has been submitted to the SSAP webservice.
Giving up on SSAP job SID4617563619626832 because submission time of Sun Aug 26 09:16:49 2007 is more than 172800 seconds older than current time (Tue Aug 28 10:23:24 2007).
SSAP job SID4617563619626832 is not yet finished.
The entry "2oktA01" has been submitted to the SSAP webservice.
The entry "2oktA01" has been submitted to the SSAP webservice.
Giving up on SSAP job SID1230395093029536 because submission time of Thu Aug 23 22:38:57 2007 is more than 172800 seconds older than current time (Sun Aug 26 03:01:25 2007).
SSAP job SID1230395093029536 is not yet finished.
The entry "2oktA01" has been submitted to the SSAP webservice.
The entry "2oktA01" has been submitted to the SSAP webservice.
Giving up on SSAP job SID8907232459204416 because submission time of Tue Aug 21 11:00:49 2007 is more than 172800 seconds older than current time (Thu Aug 23 19:41:29 2007).
SSAP job SID8907232459204416 is not yet finished.
The entry "2oktA01" has been submitted to the SSAP webservice.
The entry "2oktA01" has been submitted to the SSAP webservice.
Giving up on SSAP job SID6867722921607924 because submission time of Sun Aug 19 07:41:02 2007 is more than 172800 seconds older than current time (Tue Aug 21 08:22:37 2007).
SSAP job SID6867722921607924 is not yet finished.
The entry "2oktA01" has been submitted to the SSAP webservice.
The entry "2oktA01" has been submitted to the SSAP webservice.
Giving up on SSAP job SID0024874834410288 because submission time of Thu Aug 16 23:32:06 2007 is more than 172800 seconds older than current time (Sun Aug 19 03:40:55 2007).
SSAP job SID0024874834410288 is not yet finished.
The entry "2oktA01" has been submitted to the SSAP webservice.
The entry "2oktA01" has been submitted to the SSAP webservice.
Giving up on SSAP job SID1204169576941520 because submission time of Tue Aug 14 09:16:17 2007 is more than 172800 seconds older than current time (Thu Aug 16 18:41:21 2007).
SSAP job SID1204169576941520 is not yet finished.
The entry "2oktA01" has been submitted to the SSAP webservice.
The entry "2oktA01" has been submitted to the SSAP webservice.
Retrieved PRC results for job ID SID0007548945202384 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 20 results for 2oktA01
The entry "2oktA01" has been submitted to the PRC webservice.
The entry "2oktA01" has been submitted to the PRC webservice.
Retrieved HMM(SAM) results for job ID SID7621719896389200 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 9 results for 2oktA01
HMM(SAM) job SID7621719896389200 is not yet finished.
The entry "2oktA01" has been submitted to the HMM (SAM) webservice.
The entry "2oktA01" has been submitted to the HMM (SAM) webservice.
Retrieved "2oktA01" CATHEDRAL results for job ID SID3393746010596800 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 69 results for 2oktA01
"2oktA01" CATHEDRAL job SID3393746010596800 is not yet finished.
The entry "2oktA01" has been submitted to the CATHEDRAL webservice.
The entry "2oktA01" has been submitted to the CATHEDRAL webservice.
ScanList with 9778 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2oktA01.scanlist" for "2oktA01"
Writing ScanList containing 9778 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2oktA01.scanlist" for domain "2oktA01"
Waiting for 984 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Waiting for 1052 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Waiting for 1095 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Waiting for 1146 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Waiting for 1198 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Waiting for 1261 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Waiting for 1336 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1377 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1412 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1457 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1505 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1577 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1645 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1704 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1742 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1792 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1837 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1893 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1975 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 2056 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 2116 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 2178 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 2230 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 2293 new domains (example : 1t6pD03) to be processed so that they can be scanned against too.
Waiting for 2348 new domains (example : 1rqrB02) to be processed so that they can be scanned against too.
Waiting for 2404 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 2415 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 2528 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 2652 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 2828 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 2883 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 2924 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 2965 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3034 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3098 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3152 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3197 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3216 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3206 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3198 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3055 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3126 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3204 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3254 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
No satisfactory AssignClose result found.
No in_process hits for Domain "2oktA01" ready to be processed
NW result present for Domain "2oktA01"
All required files are present for Domain "2oktA01"
Beginning processing for Domain "2oktA01"
nice chopping