CATH Domain: 2okbA00 XML data for domain: 2okbA00

Molscript image for 2okbA00
2okbA00
PDB coordinates for domain 2okbA00

PDB 2okb, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.70 Distorted Sandwich
2.70.40 Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A
2.70.40.10 Gene3D
2.70.40.10.9
2.70.40.10.9.1
2.70.40.10.9.1.1
2.70.40.10.9.1.1.1
2.70.40.10.9.1.1.1.1

[top]
Segment boundaries for domain 2okbA00

Chopping figure for domain 2okbA00
DomainStart PDB ResidueStop PDB Residue
2okbA00 11 123

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 2.70.40.10.9.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1xs1A00 76.92 Pyrimidine metabolismMetabolic pathwaysDCTP deaminase activityDCTP deaminase [EC:3.5.4.13]Deoxycytidine triphosphate deaminase 2.70.40.10 193 23 55 2.51 4.53
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2okbA00
MFVKETNRAKSPTRQSPGAAGYDLYSAYDYTIPPGERQLIKTDISMSMPKFCYGRIAPRSGLSLKGIDIGGGVIDEDYRG
NIGVILINNGKCTFNVNTGDRIAQLIYQRIYYP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2okbA00
MFVKETNRAKSPTRQSPGAAGYDLYSAYDYTIPPGERQLIKTDISMSMPKFCYGRIAPRSGLSLKGIDIGGGVIDEDYRG
NIGVILINNGKCTFNVNTGDRIAQLIYQRIYYP
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 15 Aug 2007 01:03

Assigning to "2.70.40.10" based on similarity with "2okbB00"

Flow stage update by auto on 15 Aug 2007 00:09

No in_process hits for Domain "2okbA00" ready to be processed

Update comment by auto on 14 Aug 2007 22:51

Domain "2okbA00" hits Domain "2okeB00" (99.1150442477876% over 86.2595419847328%) which is currently in process

Flow stage update by auto on 02 Aug 2007 19:02

Domain "2okbA00" hits Domain "2okbB00" (100% over 100%) which is currently in process

Flow stage update by auto on 02 Aug 2007 19:02

NW result present for Domain "2okbA00"

Flow stage update by auto on 16 Jul 2007 22:39

All required files are present for Domain "2okbA00"

Flow stage update by auto on 14 Jul 2007 17:56

Beginning processing for Domain "2okbA00"

Insertion by auto on 14 Jul 2007 16:46

Final ChopClose added based on similarity with "2okbB"