CATH Domain: 2ojhA00 XML data for domain: 2ojhA00

Molscript image for 2ojhA00
2ojhA00
PDB coordinates for domain 2ojhA00

PDB 2ojh, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.120 6 Propellor
2.120.10 Neuraminidase
2.120.10.30 TolB, C-terminal domain Gene3D
2.120.10.30.8
2.120.10.30.8.1
2.120.10.30.8.1.1
2.120.10.30.8.1.1.1
2.120.10.30.8.1.1.1.1

[top]
Segment boundaries for domain 2ojhA00

Chopping figure for domain 2ojhA00
DomainStart PDB ResidueStop PDB Residue
2ojhA00 16 292

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 2.120.10.30.8.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1rwiA00 78.52 Serine/threonine protein kinase, bacterial [EC:2.7.11.1]Serine/threonine-protein kinase pknDMycobacterium tuberculosis 2.120.10.30 256 9 84 3.12 3.69
1npeA00 77.53 Mus musculusCell-matrix adhesionNidogen-1Collagen bindingBasement membrane 2.120.10.30 263 7 89 3.70 4.14
1k32A01 77.53 Tricorn proteaseTricorn protease [EC:3.4.21.-]Thermoplasma acidophilum 2.120.10.60 272 13 81 3.70 4.51
1zgkA00 71.89 Kelch-like ECH-associated protein 1NucleusCentrosomeHomo sapiensUbiquitin mediated proteolysis 2.120.10.80 273 8 83 4.18 4.98
1ofzA00 70.12 Fucose-specific lectinAleuria aurantia 2.120.10.70 312 6 72 3.58 4.96
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2ojhA00
GSRSSIEIFNIRTRKRVVWQTPELFEAPNWSPDGKYLLLNSEGLLYRLSLAGDPSPEKVDTGFATICNNDHGISPDGALY
AISDKVEFGKSAIYLLPSTGGTPRLTKNLPSYWHGWSPDGKSFTYCGIRDQVFDIYSDIDSGVETRLTHGEGRNDGPDYS
PDGRWIYFNSSRTGQQIWRVRVDGSSVERITDSAYGDWFPHPSPSGDKVVFVSYDADVFDHPRDLDVRVQLDDGGNVETL
FDLFGGQGTNSPNWSPDGDEFAYVRYFPV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2ojhA00
GSXRSSIEIFNIRTRKXRVVWQTPELFEAPNWSPDGKYLLLNSEGLLYRLSLAGDPSPEKVDTGFATICNNDHGISPDGA
LYAISDKVEFGKSAIYLLPSTGGTPRLXTKNLPSYWHGWSPDGKSFTYCGIRDQVFDIYSXDIDSGVETRLTHGEGRNDG
PDYSPDGRWIYFNSSRTGQXQIWRVRVDGSSVERITDSAYGDWFPHPSPSGDKVVFVSYDADVFDHPRDLDVRVQLXDXD
GGNVETLFDLFGGQGTXNSPNWSPDGDEFAYVRYFPVEGS
BLAST against CATH

[top]
Domain History Events (113)

Domain assigned by cuff on 18 Feb 2008 11:39

same superfamily

Domain scan prc pfamcath by auto on 25 Sep 2007 13:29

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 226 results for 2ojhA00

Domain assignment manual match h by rupa on 03 Sep 2007 12:18

High ssap score, same fold. Query domain is putative tolb domain, match domain is a tolb domain.

Homcheck review by rupa on 03 Sep 2007 12:18

High ssap score, same fold. Query domain is putative tolb domain, match domain is a tolb domain.

Flow stage update by rupa on 03 Sep 2007 12:18

High ssap score, same fold. Query domain is putative tolb domain, match domain is a tolb domain.

Homcheck allotment by rupa on 03 Sep 2007 12:15

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by rupa on 03 Sep 2007 12:15

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 02 Sep 2007 23:32

Domain "2ojhA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 02 Sep 2007 23:30

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2ojhA00

Flow stage update by auto on 02 Sep 2007 23:16

Retrieved PRC_PFAMCATH results for job ID SID4584467372967496 and results inserted.

Update comment by auto on 02 Sep 2007 19:16

PRC_PFAMCATH job SID4584467372967496 is not yet finished.

Flow stage update by auto on 02 Sep 2007 19:10

The entry "2ojhA00" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 02 Sep 2007 19:10

The entry "2ojhA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 02 Sep 2007 18:24

Retrieved SSAP results for job ID SID7483876689921632 and results inserted.

Domain scan ssap cath by auto on 02 Sep 2007 18:23

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 74 results for 2ojhA00

Update comment by auto on 31 Aug 2007 20:23

SSAP job SID7483876689921632 is not yet finished.

Ssap cath submit by auto on 31 Aug 2007 20:14

The entry "2ojhA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 31 Aug 2007 20:14

The entry "2ojhA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 30 Aug 2007 16:53

Giving up on SSAP job SID6862233653060968 because submission time of Tue Aug 28 14:57:28 2007 is more than 172800 seconds older than current time (Thu Aug 30 16:54:00 2007).

Update comment by auto on 28 Aug 2007 15:04

SSAP job SID6862233653060968 is not yet finished.

Flow stage update by auto on 28 Aug 2007 14:57

The entry "2ojhA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 28 Aug 2007 14:57

The entry "2ojhA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Aug 2007 10:23

Giving up on SSAP job SID9459628877792288 because submission time of Sun Aug 26 09:16:26 2007 is more than 172800 seconds older than current time (Tue Aug 28 10:23:03 2007).

Update comment by auto on 26 Aug 2007 09:24

SSAP job SID9459628877792288 is not yet finished.

Ssap cath submit by auto on 26 Aug 2007 09:16

The entry "2ojhA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 26 Aug 2007 09:16

The entry "2ojhA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 26 Aug 2007 03:01

Giving up on SSAP job SID7847710106110848 because submission time of Thu Aug 23 22:38:38 2007 is more than 172800 seconds older than current time (Sun Aug 26 03:01:04 2007).

Update comment by auto on 23 Aug 2007 22:48

SSAP job SID7847710106110848 is not yet finished.

Flow stage update by auto on 23 Aug 2007 22:38

The entry "2ojhA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 23 Aug 2007 22:38

The entry "2ojhA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Aug 2007 19:41

Giving up on SSAP job SID0504592065048256 because submission time of Tue Aug 21 17:59:36 2007 is more than 172800 seconds older than current time (Thu Aug 23 19:41:10 2007).

Update comment by auto on 21 Aug 2007 18:01

SSAP job SID0504592065048256 is not yet finished.

Flow stage update by auto on 21 Aug 2007 17:59

The entry "2ojhA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 21 Aug 2007 17:59

The entry "2ojhA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 21 Aug 2007 11:04

Giving up on SSAP job SID6519170090172416 because submission time of Sun Aug 19 07:40:35 2007 is more than 172800 seconds older than current time (Tue Aug 21 11:04:03 2007).

Update comment by auto on 19 Aug 2007 08:32

SSAP job SID6519170090172416 is not yet finished.

Flow stage update by auto on 19 Aug 2007 07:40

The entry "2ojhA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 19 Aug 2007 07:40

The entry "2ojhA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 19 Aug 2007 03:40

Giving up on SSAP job SID0498036854972512 because submission time of Thu Aug 16 23:31:43 2007 is more than 172800 seconds older than current time (Sun Aug 19 03:40:32 2007).

Update comment by auto on 17 Aug 2007 00:41

SSAP job SID0498036854972512 is not yet finished.

Flow stage update by auto on 16 Aug 2007 23:31

The entry "2ojhA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 16 Aug 2007 23:31

The entry "2ojhA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 18:40

Giving up on SSAP job SID9680043153127552 because submission time of Tue Aug 14 09:15:45 2007 is more than 172800 seconds older than current time (Thu Aug 16 18:40:52 2007).

Update comment by auto on 14 Aug 2007 10:42

SSAP job SID9680043153127552 is not yet finished.

Ssap cath submit by auto on 14 Aug 2007 09:15

The entry "2ojhA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 09:15

The entry "2ojhA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 07:22

Retrieved PRC results for job ID SID4538693275626650 and inserted them into the database.

Domain scan prc cath by auto on 14 Aug 2007 07:21

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 39 results for 2ojhA00

Flow stage update by auto on 13 Aug 2007 10:51

The entry "2ojhA00" has been submitted to the PRC webservice.

Prc cath submit by auto on 13 Aug 2007 10:51

The entry "2ojhA00" has been submitted to the PRC webservice.

Flow stage update by auto on 13 Aug 2007 08:57

Retrieved HMM(SAM) results for job ID SID1686742777616344 and inserted them into the database.

Domain scan sam cath by auto on 13 Aug 2007 08:57

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 18 results for 2ojhA00

Update comment by auto on 12 Aug 2007 13:15

HMM(SAM) job SID1686742777616344 is not yet finished.

Sam cath submit by auto on 12 Aug 2007 12:01

The entry "2ojhA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 12:01

The entry "2ojhA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 05:23

Retrieved "2ojhA00" CATHEDRAL results for job ID SID3915217230621872 and inserted them into the database.

Domain scan cathedral cath by auto on 12 Aug 2007 05:22

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 155 results for 2ojhA00

Update comment by auto on 11 Aug 2007 06:03

"2ojhA00" CATHEDRAL job SID3915217230621872 is not yet finished.

Cathedral cath submit by auto on 11 Aug 2007 04:35

The entry "2ojhA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 11 Aug 2007 04:35

The entry "2ojhA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 11 Aug 2007 02:43

ScanList with 9778 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2ojhA00.scanlist" for "2ojhA00"

Write scan list by auto on 11 Aug 2007 02:42

Writing ScanList containing 9778 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2ojhA00.scanlist" for domain "2ojhA00"

Update comment by auto on 10 Aug 2007 14:33

Waiting for 984 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 10:32

Waiting for 1052 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 06:46

Waiting for 1095 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 02:47

Waiting for 1146 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 22:33

Waiting for 1198 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 19:15

Waiting for 1261 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 14:59

Waiting for 1336 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 10:59

Waiting for 1377 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 06:45

Waiting for 1412 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 02:52

Waiting for 1457 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 22:35

Waiting for 1505 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 18:44

Waiting for 1577 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 14:43

Waiting for 1645 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 11:06

Waiting for 1704 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 06:52

Waiting for 1742 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 02:58

Waiting for 1792 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 22:47

Waiting for 1837 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 19:34

Waiting for 1893 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 15:16

Waiting for 1975 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 10:45

Waiting for 2056 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 06:58

Waiting for 2116 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 02:51

Waiting for 2178 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 22:38

Waiting for 2230 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 18:51

Waiting for 2293 new domains (example : 1t6pD03) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 14:45

Waiting for 2348 new domains (example : 1rqrB02) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 11:23

Waiting for 2404 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 09:19

Waiting for 2415 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 02:17

Waiting for 2528 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 19:05

Waiting for 2652 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 07:24

Waiting for 2828 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 03:15

Waiting for 2883 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 22:52

Waiting for 2924 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 19:08

Waiting for 2965 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 15:12

Waiting for 3034 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 11:12

Waiting for 3098 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 07:01

Waiting for 3152 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 03:11

Waiting for 3197 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 22:58

Waiting for 3216 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 19:54

Waiting for 3206 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 15:51

Waiting for 3198 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 11:02

Waiting for 3055 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 07:05

Waiting for 3126 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 03:03

Waiting for 3204 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 22:48

Waiting for 3254 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 19:33

Waiting for 3282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Flow stage update by auto on 02 Aug 2007 19:06

No satisfactory AssignClose result found.

Flow stage update by auto on 02 Aug 2007 19:02

No in_process hits for Domain "2ojhA00" ready to be processed

Flow stage update by auto on 02 Aug 2007 19:02

NW result present for Domain "2ojhA00"

Flow stage update by auto on 12 Jul 2007 02:02

All required files are present for Domain "2ojhA00"

Flow stage update by auto on 11 Jul 2007 16:04

Beginning processing for Domain "2ojhA00"

Insertion by cuff on 11 Jul 2007 14:57

nice chopping