CATH Domain: 2oikA00 XML data for domain: 2oikA00

Molscript image for 2oikA00
2oikA00
PDB coordinates for domain 2oikA00

PDB 2oik, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.428 HIT family, subunit A
3.30.428.10 HIT family, subunit A Gene3D
3.30.428.10.1
3.30.428.10.1.1
3.30.428.10.1.1.1
3.30.428.10.1.1.1.1
3.30.428.10.1.1.1.1.1

Segment boundaries for domain 2oikA00

Chopping figure for domain 2oikA00
DomainStart PDB ResidueStop PDB Residue
2oikA00 6 144

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.30.428.10.1.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1y23B01 83.16 Bacillus subtilisProtein hitHit-like protein involved in cell-cycle regulation 3.30.428.10 112 18 72 2.06 2.85
1kpfA00 78.98 Histidine triad nucleotide-binding protein 1NucleusCytoskeletonHomo sapiensProtein kinase C binding 3.30.428.10 111 15 71 3.02 4.22
Displaying entries 1 to 2 (page 1 of 1)


Domain ATOM Sequence

>pdb|2oikA00
SFHKNCELCTTAGGEILWQDALCRVVHVENQDYPGFCRVILNRHVKESDLRPAERDHLLVVFAVEEAVREVRPDKINLAS
LGNTPHVHWHVIPRFKRDRHFPNSVWGETKRESLPQALDQGSTTALKKAISVRLD    

Domain COMBS Sequence

>pdb|2oikA00
GXTRTXSFHKNCELCTTAGGEILWQDALCRVVHVENQDYPGFCRVILNRHVKEXSDLRPAERDHLXLVVFAVEEAVREVX
RPDKINLASLGNXTPHVHWHVIPRFKRDRHFPNSVWGETKRESLPQALDQGSTTALKKAISVRLDQGEPVFXGX    

Domain History Events (12)

Domain assigned by auto on 14 Feb 2008 17:27

Assigning to "3.30.428.10" based on similarity with "2oikD00"

Flow stage update by auto on 14 Feb 2008 17:10

No in_process hits for Domain "2oikA00" ready to be processed

Update comment by auto on 03 Sep 2007 20:10

Domain "2oikA00" hits Domain "2oikD00" (94.8051948051948% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2oikA00" hits Domain "2oikD00" (94.8051948051948% over 100%) which is currently in process

Update comment by auto on 11 Aug 2007 14:42

Domain "2oikA00" hits Domain "2oikD00" (94.8051948051948% over 100%) which is currently in process

Update comment by auto on 10 Aug 2007 23:26

Domain "2oikA00" hits Domain "2oikD00" (94.8051948051948% over 100%) which is currently in process

Update comment by auto on 02 Aug 2007 14:57

Domain "2oikA00" hits Domain "2oikD00" (94.8051948051948% over 100%) which is currently in process

Flow stage update by auto on 02 Aug 2007 14:52

Domain "2oikA00" hits Domain "2oikD00" (94.8051948051948% over 100%) which is currently in process

Flow stage update by auto on 02 Aug 2007 14:52

NW result present for Domain "2oikA00"

Flow stage update by auto on 12 Jul 2007 02:02

All required files are present for Domain "2oikA00"

Flow stage update by auto on 11 Jul 2007 16:04

Beginning processing for Domain "2oikA00"

Insertion by auto on 11 Jul 2007 16:02

Final ChopClose added based on similarity with "2oikC"