CATH Domain: 2oh3A01 XML data for domain: 2oh3A01

Molscript image for 2oh3A01
2oh3A01
PDB coordinates for domain 2oh3A01

PDB 2oh3, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1260 Ferritin;
1.20.1260.10 Gene3D
1.20.1260.10.19
1.20.1260.10.19.1
1.20.1260.10.19.1.1
1.20.1260.10.19.1.1.1
1.20.1260.10.19.1.1.1.1

[top]
Segment boundaries for domain 2oh3A01

Chopping figure for domain 2oh3A01
DomainStart PDB ResidueStop PDB Residue
2oh3A01 3 149

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 1.20.1260.10.19.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2qqyA00 86.42 Bacillus anthracisBacterioferritinPutative uncharacterized protein 1.20.1260.10 133 19 88 3.16 3.56
2ib0A01 85.04 Mycobacterium tuberculosisCONSERVED HYPOTHETICAL ALANINE RICH PROTEIN 1.20.1260.10 135 11 90 3.44 3.81
2fjcB00 84.03 Treponema pallidumStarvation-inducible DNA-binding proteinAntigen TpF1 1.20.1260.10 156 9 80 3.09 3.83
2yw6B00 82.81 Mycobacterium smegmatisDNA protection during starvation proteinStarvation-inducible DNA-binding protein 1.20.1260.10 150 8 85 3.41 4.00
2itbB00 78.35 TRNA-(Ms(2)io(6)a)-hydroxylase, putativeTRNA-(ms[2]io[6]A)-hydroxylase [EC:1.-.-.-]Pseudomonas putida KT2440 1.20.1260.10 193 15 67 3.30 4.90
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2oh3A01
YTLAEFLAHAIALETEAAERYVELADEAHNNLDTATVFRDARFSTLHGDEIKQRSRALELPKLSWQYRWKTPPEVGDEHY
LTPYHALRYARDNEIRGEYYKEAAANSADPEVKRLGADFAAEEAEHVVALDKWIEKTP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2oh3A01
GXGYTLAEFLAHAIALETEAAERYVELADXXEAHNNLDTATVFRDXARFSTLHGDEIKQRSRALELPKLXSWQYRWKTPP
EVGDENDIHYLXTPYHALRYARDNEIRGXEYYKEAAANSADPEVKRLGADFAAEEAEHVVALDKWIEKTP
BLAST against CATH

[top]
Domain History Events (116)

Domain assigned by cuff on 14 Feb 2008 16:48

same superfamily

Domain assignment manual match h by cuff on 14 Feb 2008 16:46

similar functions and structure

Domain scan prc pfamcath by auto on 25 Sep 2007 13:23

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 54 results for 2oh3A01

Domain assignment manual match t by tronnberg on 03 Sep 2007 12:07

SSAP: 84.43 OV: 79 SEQ: 16. Similar linkage. Both are metal binding domains. The reason why I did not assign the query to the same H- class as the match is because there are no details about what type of metal binding domain the query is.

Homcheck review by tronnberg on 03 Sep 2007 12:07

SSAP: 84.43 OV: 79 SEQ: 16. Similar linkage. Both are metal binding domains. The reason why I did not assign the query to the same H- class as the match is because there are no details about what type of metal binding domain the query is.

Flow stage update by tronnberg on 03 Sep 2007 12:07

SSAP: 84.43 OV: 79 SEQ: 16. Similar linkage. Both are metal binding domains. The reason why I did not assign the query to the same H- class as the match is because there are no details about what type of metal binding domain the query is.

Homcheck allotment by tronnberg on 03 Sep 2007 12:00

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 03 Sep 2007 12:00

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 02 Sep 2007 15:25

Domain "2oh3A01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 02 Sep 2007 15:25

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2oh3A01

Flow stage update by auto on 02 Sep 2007 14:59

Retrieved PRC_PFAMCATH results for job ID SID0695669385286320 and results inserted.

Update comment by auto on 02 Sep 2007 11:30

PRC_PFAMCATH job SID0695669385286320 is not yet finished.

Prc pfamcath submit by auto on 02 Sep 2007 11:26

The entry "2oh3A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 02 Sep 2007 11:26

The entry "2oh3A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 02 Sep 2007 10:33

Retrieved SSAP results for job ID SID9855187473140656 and results inserted.

Domain scan ssap cath by auto on 02 Sep 2007 10:31

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1812 results for 2oh3A01

Update comment by auto on 31 Aug 2007 20:23

SSAP job SID9855187473140656 is not yet finished.

Ssap cath submit by auto on 31 Aug 2007 20:14

The entry "2oh3A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 31 Aug 2007 20:14

The entry "2oh3A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 30 Aug 2007 16:53

Giving up on SSAP job SID3403940990410960 because submission time of Tue Aug 28 14:57:10 2007 is more than 172800 seconds older than current time (Thu Aug 30 16:53:37 2007).

Update comment by auto on 28 Aug 2007 15:03

SSAP job SID3403940990410960 is not yet finished.

Flow stage update by auto on 28 Aug 2007 14:57

The entry "2oh3A01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 28 Aug 2007 14:57

The entry "2oh3A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Aug 2007 10:22

Giving up on SSAP job SID0804428250781952 because submission time of Sun Aug 26 09:16:04 2007 is more than 172800 seconds older than current time (Tue Aug 28 10:22:44 2007).

Update comment by auto on 26 Aug 2007 09:24

SSAP job SID0804428250781952 is not yet finished.

Ssap cath submit by auto on 26 Aug 2007 09:16

The entry "2oh3A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 26 Aug 2007 09:16

The entry "2oh3A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 26 Aug 2007 03:00

Giving up on SSAP job SID5023585295797536 because submission time of Thu Aug 23 22:38:20 2007 is more than 172800 seconds older than current time (Sun Aug 26 03:00:43 2007).

Update comment by auto on 23 Aug 2007 22:48

SSAP job SID5023585295797536 is not yet finished.

Ssap cath submit by auto on 23 Aug 2007 22:38

The entry "2oh3A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Aug 2007 22:38

The entry "2oh3A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Aug 2007 19:40

Giving up on SSAP job SID8381658767712096 because submission time of Tue Aug 21 11:00:14 2007 is more than 172800 seconds older than current time (Thu Aug 23 19:40:49 2007).

Update comment by auto on 21 Aug 2007 11:40

SSAP job SID8381658767712096 is not yet finished.

Flow stage update by auto on 21 Aug 2007 11:00

The entry "2oh3A01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 21 Aug 2007 11:00

The entry "2oh3A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 21 Aug 2007 08:21

Giving up on SSAP job SID0980781908576056 because submission time of Sun Aug 19 07:40:10 2007 is more than 172800 seconds older than current time (Tue Aug 21 08:21:54 2007).

Update comment by auto on 19 Aug 2007 08:31

SSAP job SID0980781908576056 is not yet finished.

Ssap cath submit by auto on 19 Aug 2007 07:40

The entry "2oh3A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 19 Aug 2007 07:40

The entry "2oh3A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 19 Aug 2007 03:40

Giving up on SSAP job SID6693393105024912 because submission time of Thu Aug 16 23:31:21 2007 is more than 172800 seconds older than current time (Sun Aug 19 03:40:08 2007).

Update comment by auto on 17 Aug 2007 00:40

SSAP job SID6693393105024912 is not yet finished.

Ssap cath submit by auto on 16 Aug 2007 23:31

The entry "2oh3A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 23:31

The entry "2oh3A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 18:40

Giving up on SSAP job SID3543290983745728 because submission time of Tue Aug 14 09:15:12 2007 is more than 172800 seconds older than current time (Thu Aug 16 18:40:24 2007).

Update comment by auto on 14 Aug 2007 10:42

SSAP job SID3543290983745728 is not yet finished.

Flow stage update by auto on 14 Aug 2007 09:15

The entry "2oh3A01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 14 Aug 2007 09:15

The entry "2oh3A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 07:18

Retrieved PRC results for job ID SID0105461249616992 and inserted them into the database.

Domain scan prc cath by auto on 14 Aug 2007 07:17

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 23 results for 2oh3A01

Flow stage update by auto on 13 Aug 2007 22:24

The entry "2oh3A01" has been submitted to the PRC webservice.

Prc cath submit by auto on 13 Aug 2007 22:24

The entry "2oh3A01" has been submitted to the PRC webservice.

Flow stage update by auto on 13 Aug 2007 22:16

Retrieved HMM(SAM) results for job ID SID4803653429991428 and inserted them into the database.

Domain scan sam cath by auto on 13 Aug 2007 22:15

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 3 results for 2oh3A01

Update comment by auto on 12 Aug 2007 13:14

HMM(SAM) job SID4803653429991428 is not yet finished.

Flow stage update by auto on 12 Aug 2007 12:01

The entry "2oh3A01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 12 Aug 2007 12:00

The entry "2oh3A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 05:17

Retrieved "2oh3A01" CATHEDRAL results for job ID SID0599341650665792 and inserted them into the database.

Domain scan cathedral cath by auto on 12 Aug 2007 05:15

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 358 results for 2oh3A01

Update comment by auto on 11 Aug 2007 06:03

"2oh3A01" CATHEDRAL job SID0599341650665792 is not yet finished.

Flow stage update by auto on 11 Aug 2007 04:34

The entry "2oh3A01" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 11 Aug 2007 04:33

The entry "2oh3A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 11 Aug 2007 02:42

ScanList with 9778 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2oh3A01.scanlist" for "2oh3A01"

Write scan list by auto on 11 Aug 2007 02:41

Writing ScanList containing 9778 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2oh3A01.scanlist" for domain "2oh3A01"

Update comment by auto on 10 Aug 2007 14:33

Waiting for 984 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 10:32

Waiting for 1052 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 06:46

Waiting for 1095 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 02:47

Waiting for 1146 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 22:33

Waiting for 1198 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 19:15

Waiting for 1261 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 14:59

Waiting for 1336 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 10:59

Waiting for 1377 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 06:45

Waiting for 1412 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 02:52

Waiting for 1457 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 22:35

Waiting for 1505 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 18:43

Waiting for 1577 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 14:43

Waiting for 1645 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 11:06

Waiting for 1704 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 06:52

Waiting for 1742 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 02:58

Waiting for 1792 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 22:47

Waiting for 1837 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 19:34

Waiting for 1893 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 15:15

Waiting for 1975 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 10:45

Waiting for 2056 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 06:58

Waiting for 2116 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 02:51

Waiting for 2178 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 22:38

Waiting for 2230 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 18:51

Waiting for 2293 new domains (example : 1t6pD03) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 14:45

Waiting for 2348 new domains (example : 1rqrB02) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 11:23

Waiting for 2404 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 09:19

Waiting for 2415 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 02:16

Waiting for 2528 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 19:05

Waiting for 2652 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 07:24

Waiting for 2828 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 03:15

Waiting for 2883 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 22:52

Waiting for 2924 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 19:08

Waiting for 2965 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 15:12

Waiting for 3034 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 11:11

Waiting for 3098 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 07:01

Waiting for 3152 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 03:11

Waiting for 3197 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 22:58

Waiting for 3216 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 19:54

Waiting for 3206 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 15:51

Waiting for 3198 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 11:02

Waiting for 3055 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 07:05

Waiting for 3126 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 03:03

Waiting for 3204 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 22:48

Waiting for 3254 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 19:33

Waiting for 3282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 15:26

Waiting for 3339 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 11:07

Waiting for 3395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Flow stage update by auto on 02 Aug 2007 10:38

No satisfactory AssignClose result found.

Flow stage update by auto on 02 Aug 2007 10:35

No in_process hits for Domain "2oh3A01" ready to be processed

Flow stage update by auto on 02 Aug 2007 10:34

NW result present for Domain "2oh3A01"

Flow stage update by auto on 12 Jul 2007 02:02

All required files are present for Domain "2oh3A01"

Flow stage update by auto on 11 Jul 2007 16:04

Beginning processing for Domain "2oh3A01"

Insertion by cuff on 11 Jul 2007 14:57

nice chopping