CATH Domain: 2oh1C00

There are 32 matching structural neighberhood comparisons for CATH ID 3.40.630.30.5.1.1.1.1 (SIMAX score < 5)

Match Depth	Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
	1tiqB00	82.98	Bacillus subtilisProtease synthase and sporulation negative regulatory protein PAI 1	3.40.630.30	161	15	85	3.62	4.23
	3g8wA00	82.35	Staphylococcus epidermidis ATCC 12228Lactococcal prophage ps3 protein 05	3.40.630.30	158	6	82	3.32	4.02
	3d3sA00	80.80	L-2,4-diaminobutyric acid acetyltransferaseGlycine, serine and threonine metabolismBordetella parapertussisL-2,4-diaminobutyric acid acetyltransferase [EC:2.3.1.178]Metabolic pathways	3.40.630.30	157	10	80	2.92	3.62
	2fiaA00	80.60	Acetyltransferase, GNAT familyEnterococcus faecalis	3.40.630.30	157	14	85	3.35	3.92
	2i79D00	80.57	Acetyltransferase, GNAT familyStreptococcus pneumoniae	3.40.630.30	167	13	85	4.02	4.73
	2fiwA00	79.90	Putative acetyltransferase [EC:2.3.1.-]GCN5-related N-acetyltransferase:Aminotransferase, class-IIRhodopseudomonas palustris	3.40.630.30	156	12	83	3.69	4.41
	2pdoA01	79.67	Shigella flexneriAcetyltransferase ypeA	3.40.630.30	118	18	68	2.62	3.85
	1mk4A00	79.59	Bacillus subtilisUncharacterized protein yqjY	3.40.630.30	157	7	81	2.95	3.60
	3k9uA00	79.44	Putative uncharacterized protein Ta0374Thermoplasma acidophilum	3.40.630.30	159	12	83	3.85	4.60
	3exnA00	79.41	Tyrosine metabolismLimonene and pinene degradation1- and 2-Methylnaphthalene degradationPhenylalanine metabolismBenzoate degradation via CoA ligation	3.40.630.30	151	9	86	3.85	4.47
	3d8pB00	79.40	Staphylococcus aureus subsp. aureus Mu50Putative uncharacterized protein	3.40.630.30	157	13	83	3.74	4.50
	1qstA00	79.02	HAT A1Tetrahymena thermophila	3.40.630.30	160	7	80	3.40	4.24
	2r1iA01	78.72	Arthrobacter sp. FB24GCN5-related N-acetyltransferase	3.40.630.30	129	12	69	3.46	4.95
	1xebA00	78.52	Pseudomonas aeruginosaElaA proteinPutative uncharacterized protein	3.40.630.30	146	11	76	3.36	4.39
	3efaA00	78.41	Tyrosine metabolismBenzoate degradation via CoA ligationLactobacillus plantarumAcetyltransferase (Putative)Limonene and pinene degradation	3.40.630.30	141	13	77	2.99	3.88
	2r7hB00	78.35	Desulfovibrio desulfuricans subsp. desulfuricans str. G20Putative uncharacterized protein	3.40.630.30	157	14	85	3.76	4.40
	3fncA00	78.24	Listeria innocuaLin0611 protein	3.40.630.30	157	12	83	3.71	4.46
	2hqyA02	78.16	Hypothetical proteinBacteroides thetaiotaomicronPutative uncharacterized protein	3.40.630.30	164	6	81	3.53	4.31
	2q7bA00	78.03	Acetyltransferase, GNAT familyStreptococcus agalactiae serogroup V	3.40.630.30	161	11	84	4.02	4.77
	3f5bA00	77.78	Aminoglycoside N(6')acetyltransferaseLegionella pneumophila subsp. pneumophila str. Philadelphia 1	3.40.630.30	163	11	86	3.96	4.56
	3blnA00	77.75	Bacillus cereus ATCC 10987Putative uncharacterized protein	3.40.630.30	139	12	78	3.74	4.78
	2ge3B00	77.16	Agrobacterium tumefaciens str. C58Probable acetyltransferase	3.40.630.30	159	6	84	4.11	4.84
	3fbuA00	77.15	Bacillus anthracisAcetyltransferase, GNAT family	3.40.630.30	166	9	86	4.17	4.84
	1m4iB00	77.04	Aminoglycoside 2'-N-acetyltransferaseMycobacterium tuberculosis	3.40.630.30	176	9	76	3.38	4.44
	3gkrA02	76.74	Weissella viridescensFemX	3.40.630.30	165	9	75	3.64	4.80
	2fckA00	76.60	Vibrio choleraeRibosomal-protein-serine acetyltransferase, putative	3.40.630.30	171	8	83	4.09	4.93
	2pr1A00	76.54	Uncharacterized N-acetyltransferase ylbPBacillus subtilis	3.40.630.30	152	7	78	3.83	4.85
	1n71B00	76.09	Aac(6')-Ii proteinEnterococcus faecium	3.40.630.30	179	10	74	3.69	4.97
	2fl4A02	75.50	Arginine and proline metabolismSpermine/spermidine acetyltransferase, putativeDiamine N-acetyltransferase [EC:2.3.1.57]Metabolic pathwaysEnterococcus faecalis	3.40.630.30	104	20	57	2.42	4.23
	2fsrA00	75.45	Agrobacterium tumefaciens str. C58Acetyltranferase	3.40.630.30	168	9	84	4.15	4.91
	1ro5A01	75.03	Pseudomonas aeruginosaAcyl homoserine lactone synthase [EC:2.3.1.184]Acyl-homoserine-lactone synthase	3.40.630.30	187	9	77	3.85	5.00
	3ey5A01	74.98	Acetyltransferase-like, GNAT familyBacteroides thetaiotaomicron	3.40.630.30	144	8	71	3.22	4.53

>pdb|2oh1C00
NKITAGGLEFLVRFAAPTDRLKINDLIDTARWLKESGSTQWSDILHGFDVHNIEQRIELGEVALFETEAGALAGAIIRKT
PSDWDTDLWEDLAIDKAYYLHRIVSRAFSGISLSKQIYFAEKLGIESVPFIRLDCIESNETLNQYVRYGFQFSGKKNGFY
LYQKEL    

>pdb|2oh1C00
GXNQNKITAGGLEFLVRFAAPTDRLKINDLXIDTARWLKESGSTQWSDILHGFDVHNIEQRIELGEVALFETEAGALAGA
XIIRKTPSDWDTDLWEDLAIDKAYYLHRIXVSRAFSGISLSKQXIYFAEKLGIEXSVPFIRLDCIESNETLNQXYVRYGF
QFSGKKNGFYLYQKELSQK