CATH Domain: 2ogjA01 XML data for domain: 2ogjA01

Molscript image for 2ogjA01
2ogjA01
PDB coordinates for domain 2ogjA01

PDB 2ogj, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.30 Roll
2.30.40 Urease, subunit C; domain 1
2.30.40.10 Urease, subunit C, domain 1 Gene3D
2.30.40.10.11
2.30.40.10.11.1
2.30.40.10.11.1.1
2.30.40.10.11.1.1.1
2.30.40.10.11.1.1.1.1

[top]
Segment boundaries for domain 2ogjA01

Chopping figure for domain 2ogjA01
DomainStart PDB ResidueStop PDB Residue
2ogjA01 14 72
2ogjA01 339 396
2ogjA02 73 338

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 2.30.40.10.11.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2icsA01 85.63 Pyrimidine metabolismDihydroorotase [EC:3.5.2.3]Metabolic pathwaysEnterococcus faecalisPutative uncharacterized protein 2.30.40.10 100 27 85 2.65 3.11
2vhlB01 82.78 Amino sugar and nucleotide sugar metabolismN-acetylglucosamine-6-phosphate deacetylaseBacillus subtilisN-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25] 2.30.40.10 92 17 77 3.59 4.64
2pajA01 81.59 2.30.40.10 119 17 82 3.23 3.92
1yrrA01 80.40 Amino sugar and nucleotide sugar metabolismEscherichia coli O157:H7N-acetylglucosamine-6-phosphate deacetylaseN-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25] 2.30.40.10 92 22 73 2.34 3.20
2oodA01 76.01 Bradyrhizobium japonicumGuanine deaminase [EC:3.5.4.3]Purine metabolismBlr3880 proteinMetabolic pathways 2.30.40.10 135 14 70 3.30 4.69
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2ogjA01
QAPILLTNVKPVGFGKGASQSSTDILIGGDGKIAAVGSALQAPADTQRIDAAFISPGNRLDVGQRADFTVFDLVDADLEA
TDSNGDVSRLKRLFEPRYAVIGAEAIAASRYIPRA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2ogjA01
XSLTSGEQAKTPLQAPILLTNVKPVGFGKGASQSSTDILIGGDGKIAAVGSALQAPADTQRIDAKGAFISPGNRLDVGQR
ADFTVFDLVDADLEATDSNGDVSRLKRLFEPRYAVIGAEAIAASRYIPRA
BLAST against CATH

[top]
Domain History Events (114)

Domain assigned by cuff on 14 Feb 2008 16:35

i agree, same superfamily

Domain scan prc pfamcath by auto on 25 Sep 2007 13:04

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 49 results for 2ogjA01

Domain assignment manual match h by rupa on 03 Sep 2007 11:59

Very high ssap score, same fold, same function.

Homcheck review by rupa on 03 Sep 2007 11:59

Very high ssap score, same fold, same function.

Flow stage update by rupa on 03 Sep 2007 11:59

Very high ssap score, same fold, same function.

Homcheck allotment by rupa on 03 Sep 2007 11:57

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by rupa on 03 Sep 2007 11:57

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 02 Sep 2007 05:50

Domain "2ogjA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 02 Sep 2007 05:50

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2ogjA01

Flow stage update by auto on 02 Sep 2007 03:56

Retrieved PRC_PFAMCATH results for job ID SID3580738440886016 and results inserted.

Flow stage update by auto on 02 Sep 2007 03:13

The entry "2ogjA01" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 02 Sep 2007 03:13

The entry "2ogjA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 02 Sep 2007 02:50

Retrieved SSAP results for job ID SID2080501081574792 and results inserted.

Domain scan ssap cath by auto on 02 Sep 2007 02:49

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 682 results for 2ogjA01

Update comment by auto on 31 Aug 2007 20:22

SSAP job SID2080501081574792 is not yet finished.

Ssap cath submit by auto on 31 Aug 2007 20:13

The entry "2ogjA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 31 Aug 2007 20:13

The entry "2ogjA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 30 Aug 2007 16:53

Giving up on SSAP job SID4195928799885476 because submission time of Tue Aug 28 14:56:46 2007 is more than 172800 seconds older than current time (Thu Aug 30 16:53:09 2007).

Update comment by auto on 28 Aug 2007 15:03

SSAP job SID4195928799885476 is not yet finished.

Flow stage update by auto on 28 Aug 2007 14:56

The entry "2ogjA01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 28 Aug 2007 14:56

The entry "2ogjA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Aug 2007 10:22

Giving up on SSAP job SID9916435454165152 because submission time of Sun Aug 26 09:15:32 2007 is more than 172800 seconds older than current time (Tue Aug 28 10:22:19 2007).

Update comment by auto on 26 Aug 2007 09:24

SSAP job SID9916435454165152 is not yet finished.

Ssap cath submit by auto on 26 Aug 2007 09:15

The entry "2ogjA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 26 Aug 2007 09:15

The entry "2ogjA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 26 Aug 2007 03:00

Giving up on SSAP job SID3940221646562208 because submission time of Thu Aug 23 22:37:55 2007 is more than 172800 seconds older than current time (Sun Aug 26 03:00:16 2007).

Update comment by auto on 23 Aug 2007 22:47

SSAP job SID3940221646562208 is not yet finished.

Ssap cath submit by auto on 23 Aug 2007 22:37

The entry "2ogjA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Aug 2007 22:37

The entry "2ogjA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Aug 2007 19:40

Giving up on SSAP job SID8175809705027136 because submission time of Tue Aug 21 10:59:47 2007 is more than 172800 seconds older than current time (Thu Aug 23 19:40:24 2007).

Update comment by auto on 21 Aug 2007 11:40

SSAP job SID8175809705027136 is not yet finished.

Ssap cath submit by auto on 21 Aug 2007 10:59

The entry "2ogjA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 21 Aug 2007 10:59

The entry "2ogjA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 21 Aug 2007 08:21

Giving up on SSAP job SID2439179214885920 because submission time of Sun Aug 19 07:39:38 2007 is more than 172800 seconds older than current time (Tue Aug 21 08:21:23 2007).

Update comment by auto on 19 Aug 2007 08:31

SSAP job SID2439179214885920 is not yet finished.

Ssap cath submit by auto on 19 Aug 2007 07:39

The entry "2ogjA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 19 Aug 2007 07:39

The entry "2ogjA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 19 Aug 2007 03:39

Giving up on SSAP job SID8753631582964480 because submission time of Thu Aug 16 23:30:54 2007 is more than 172800 seconds older than current time (Sun Aug 19 03:39:37 2007).

Update comment by auto on 17 Aug 2007 00:40

SSAP job SID8753631582964480 is not yet finished.

Ssap cath submit by auto on 16 Aug 2007 23:30

The entry "2ogjA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 23:30

The entry "2ogjA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 18:39

Giving up on SSAP job SID5375691472634240 because submission time of Tue Aug 14 09:14:20 2007 is more than 172800 seconds older than current time (Thu Aug 16 18:39:52 2007).

Update comment by auto on 14 Aug 2007 10:41

SSAP job SID5375691472634240 is not yet finished.

Flow stage update by auto on 14 Aug 2007 09:14

The entry "2ogjA01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 14 Aug 2007 09:14

The entry "2ogjA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 07:13

Retrieved PRC results for job ID SID9487445693128352 and inserted them into the database.

Domain scan prc cath by auto on 14 Aug 2007 07:13

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 17 results for 2ogjA01

Prc cath submit by auto on 13 Aug 2007 22:24

The entry "2ogjA01" has been submitted to the PRC webservice.

Flow stage update by auto on 13 Aug 2007 22:24

The entry "2ogjA01" has been submitted to the PRC webservice.

Flow stage update by auto on 13 Aug 2007 22:15

Retrieved HMM(SAM) results for job ID SID4689788045220000 and inserted them into the database.

Domain scan sam cath by auto on 13 Aug 2007 22:14

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 2ogjA01

Update comment by auto on 12 Aug 2007 13:14

HMM(SAM) job SID4689788045220000 is not yet finished.

Sam cath submit by auto on 12 Aug 2007 12:00

The entry "2ogjA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 12:00

The entry "2ogjA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 05:10

Retrieved "2ogjA01" CATHEDRAL results for job ID SID8953560411619455 and inserted them into the database.

Domain scan cathedral cath by auto on 12 Aug 2007 05:09

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 162 results for 2ogjA01

Update comment by auto on 11 Aug 2007 06:02

"2ogjA01" CATHEDRAL job SID8953560411619455 is not yet finished.

Flow stage update by auto on 11 Aug 2007 04:33

The entry "2ogjA01" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 11 Aug 2007 04:32

The entry "2ogjA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 11 Aug 2007 02:41

ScanList with 9778 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2ogjA01.scanlist" for "2ogjA01"

Write scan list by auto on 11 Aug 2007 02:40

Writing ScanList containing 9778 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2ogjA01.scanlist" for domain "2ogjA01"

Update comment by auto on 10 Aug 2007 14:33

Waiting for 984 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 10:32

Waiting for 1052 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 06:46

Waiting for 1095 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 02:47

Waiting for 1146 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 22:33

Waiting for 1198 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 19:14

Waiting for 1261 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 14:59

Waiting for 1336 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 10:59

Waiting for 1377 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 06:45

Waiting for 1412 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 02:52

Waiting for 1457 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 22:35

Waiting for 1505 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 18:43

Waiting for 1577 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 14:43

Waiting for 1645 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 11:06

Waiting for 1704 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 06:52

Waiting for 1742 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 02:58

Waiting for 1792 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 22:47

Waiting for 1837 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 19:33

Waiting for 1893 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 15:15

Waiting for 1975 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 10:45

Waiting for 2056 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 06:57

Waiting for 2116 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 02:51

Waiting for 2178 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 22:38

Waiting for 2230 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 18:51

Waiting for 2293 new domains (example : 1t6pD03) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 14:45

Waiting for 2348 new domains (example : 1rqrB02) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 11:23

Waiting for 2404 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 09:19

Waiting for 2415 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 02:16

Waiting for 2528 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 19:05

Waiting for 2652 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 07:24

Waiting for 2828 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 03:15

Waiting for 2883 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 22:52

Waiting for 2924 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 19:08

Waiting for 2965 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 15:12

Waiting for 3034 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 11:11

Waiting for 3098 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 07:01

Waiting for 3152 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 03:10

Waiting for 3197 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 22:58

Waiting for 3216 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 19:54

Waiting for 3206 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 15:51

Waiting for 3198 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 11:02

Waiting for 3055 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 07:05

Waiting for 3126 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 03:03

Waiting for 3204 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 22:48

Waiting for 3254 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 19:32

Waiting for 3282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 15:26

Waiting for 3339 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 11:07

Waiting for 3395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Flow stage update by auto on 02 Aug 2007 10:38

No satisfactory AssignClose result found.

Flow stage update by auto on 02 Aug 2007 10:35

No in_process hits for Domain "2ogjA01" ready to be processed

Flow stage update by auto on 02 Aug 2007 10:34

NW result present for Domain "2ogjA01"

Flow stage update by auto on 12 Jul 2007 02:02

All required files are present for Domain "2ogjA01"

Flow stage update by auto on 11 Jul 2007 20:05

Beginning processing for Domain "2ogjA01"

Insertion by auto on 11 Jul 2007 20:01

Final ChopClose added based on similarity with "2ogjB"