CATH Domain: 2ogiB00 XML data for domain: 2ogiB00

Molscript image for 2ogiB00
2ogiB00
PDB coordinates for domain 2ogiB00

PDB 2ogi, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.3210 Hypothetical protein af1432
1.10.3210.10 Hypothetical protein af1432 Gene3D
1.10.3210.10.4
1.10.3210.10.4.1
1.10.3210.10.4.1.1
1.10.3210.10.4.1.1.1
1.10.3210.10.4.1.1.1.1

Segment boundaries for domain 2ogiB00

Chopping figure for domain 2ogiB00
DomainStart PDB ResidueStop PDB Residue
2ogiB00 2 195

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


Domain ATOM Sequence

>pdb|2ogiB00
TYKDYTGLDRTELLSKVRHSDKRFNHVLGVERAAIELAERYGYDKEKAGLAALLHDYAKELSDDEFLRLIDKYQPDPDLK
KWGNNIWHGLVGIYKIQEDLAIKDQDILAAIAKHTVGSAQSTLDKIVYVADYIEHNRDFPGVEEARELAKVDLNKAVAYE
TARTVAFLASKAQPIYPKTIETYNAYIPYLD    

Domain COMBS Sequence

>pdb|2ogiB00
GXTYKDYTGLDRTELLSKVRHXXSDKRFNHVLGVERAAIELAERYGYDKEKAGLAALLHDYAKELSDDEFLRLIDKYQPD
PDLKKWGNNIWHGLVGIYKIQEDLAIKDQDILAAIAKHTVGSAQXSTLDKIVYVADYIEHNRDFPGVEEARELAKVDLNK
AVAYETARTVAFLASKAQPIYPKTIETYNAYIPYLD    

Domain History Events (12)

Domain assigned by auto on 17 Oct 2008 15:32

Assigning to "1.10.3210.10" based on similarity with "2o08A00"

Flow stage update by auto on 17 Oct 2008 15:26

No in_process hits for Domain "2ogiB00" ready to be processed

Update comment by auto on 17 Oct 2008 15:09

Domain "2ogiB00" hits Domain "2o08B00" (42.0212765957447% over 95.9183673469388%) which is currently in process

Update comment by auto on 23 Jul 2008 18:00

Domain "2ogiB00" hits Domain "2o08A00" (42.0212765957447% over 95.9183673469388%) which is currently in process

Update comment by auto on 03 Sep 2007 20:10

Domain "2ogiB00" hits Domain "2o08A00" (42.0212765957447% over 95.9183673469388%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2ogiB00" hits Domain "2o08A00" (42.0212765957447% over 95.9183673469388%) which is currently in process

Update comment by auto on 27 Aug 2007 22:06

Domain "2ogiB00" hits Domain "2o08A00" (42.0212765957447% over 95.9183673469388%) which is currently in process

Flow stage update by auto on 27 Aug 2007 22:05

Domain "2ogiB00" hits Domain "2o08A00" (42.0212765957447% over 95.9183673469388%) which is currently in process

Flow stage update by auto on 27 Aug 2007 22:05

NW result present for Domain "2ogiB00"

Flow stage update by auto on 21 Aug 2007 10:06

All required files are present for Domain "2ogiB00"

Flow stage update by auto on 20 Aug 2007 17:33

Beginning processing for Domain "2ogiB00"

Insertion by cuff on 20 Aug 2007 10:54

nice chopping