Domain assigned by auto on 17 Oct 2008 15:32
Assigning to "1.10.3210.10" based on similarity with "2o08A00"
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|2ogiB00 TYKDYTGLDRTELLSKVRHSDKRFNHVLGVERAAIELAERYGYDKEKAGLAALLHDYAKELSDDEFLRLIDKYQPDPDLK KWGNNIWHGLVGIYKIQEDLAIKDQDILAAIAKHTVGSAQSTLDKIVYVADYIEHNRDFPGVEEARELAKVDLNKAVAYE TARTVAFLASKAQPIYPKTIETYNAYIPYLD
Assigning to "1.10.3210.10" based on similarity with "2o08A00"
No in_process hits for Domain "2ogiB00" ready to be processed
Domain "2ogiB00" hits Domain "2o08B00" (42.0212765957447% over 95.9183673469388%) which is currently in process
Domain "2ogiB00" hits Domain "2o08A00" (42.0212765957447% over 95.9183673469388%) which is currently in process
Domain "2ogiB00" hits Domain "2o08A00" (42.0212765957447% over 95.9183673469388%) which is currently in process
Domain "2ogiB00" hits Domain "2o08A00" (42.0212765957447% over 95.9183673469388%) which is currently in process
Domain "2ogiB00" hits Domain "2o08A00" (42.0212765957447% over 95.9183673469388%) which is currently in process
Domain "2ogiB00" hits Domain "2o08A00" (42.0212765957447% over 95.9183673469388%) which is currently in process
NW result present for Domain "2ogiB00"
All required files are present for Domain "2ogiB00"
Beginning processing for Domain "2ogiB00"
nice chopping