Domain assigned by cuff on 02 Apr 2008 10:34
same superfamily
CATH Domain: 2oggA01
2oggA01
PDB 2ogg, Chain A, Domain 1
Structural Neighbourhood (1 entries)
There are 1 matching structural neighberhood comparisons for CATH ID 3.40.1410.10.11.1.1.1.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 1 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
 |
3ddvB01 | 87.54 | 3.40.1410.10 | 137 | 20 | 96 | 2.25 | 2.34 |
[1]
Displaying entries 1 to 1 (page 1 of 1)
Domain ATOM Sequence
>pdb|2oggA01 TKTTVHKFGLEPPSELIQKQLRANLDDDIWEVIRSRKIDGEHVILDKDYFFRKHVPHLTKEICENSIYEYIEGELGLSIS YAQKEIVAEPCTDEDRELLDLRGYDHVVVRNYVFLEDTSLFQYTESRHRLDKF
Domain History Events (93)
Domain assignment manual match h by cuff on 11 Mar 2008 19:58
same superfamily in scop and good scores
Domain scan prc pfamcath by auto on 25 Sep 2007 12:06
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 7 results for 2oggA01
Homcheck review by tronnberg on 04 Sep 2007 16:20
SSAP: 75.95 OV: 68 SEQ: 9. Reasonable similar linkage, some secondary structual differences. I believe that 2ooiA01 (TBA) should be assign into the same topology family as the query.
Flow stage update by tronnberg on 04 Sep 2007 16:20
SSAP: 75.95 OV: 68 SEQ: 9. Reasonable similar linkage, some secondary structual differences. I believe that 2ooiA01 (TBA) should be assign into the same topology family as the query.
Domain assignment manual match t by tronnberg on 04 Sep 2007 16:20
SSAP: 75.95 OV: 68 SEQ: 9. Reasonable similar linkage, some secondary structual differences. I believe that 2ooiA01 (TBA) should be assign into the same topology family as the query.
Domain assignment manual match t by tronnberg on 21 Aug 2007 11:58
SSAp=85, seq sim=20. Function for match is unknown. Very similar link folding. I think that maybe 2ikkB00 and 2fa1A00, both are TBA, are related to the query as well.
Homcheck allotment by tronnberg on 21 Aug 2007 11:50
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by tronnberg on 21 Aug 2007 11:50
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 20 Aug 2007 12:45
Domain "2oggA01" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 20 Aug 2007 12:45
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2oggA01
Flow stage update by auto on 19 Aug 2007 03:57
Retrieved PRC_PFAMCATH results for job ID SID3294210345914816 and chopping inserted.
Update comment by auto on 18 Aug 2007 21:59
PRC_PFAMCATH job SID3294210345914816 is not yet finished.
Prc pfamcath submit by auto on 18 Aug 2007 21:47
The entry "2oggA01" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 18 Aug 2007 21:47
The entry "2oggA01" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 18 Aug 2007 20:46
Retrieved SSAP results for job ID SID5405029471396000 and chopping inserted.
Domain scan ssap cath by auto on 18 Aug 2007 20:43
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1485 results for 2oggA01
Update comment by auto on 16 Aug 2007 23:45
SSAP job SID5405029471396000 is not yet finished.
Ssap cath submit by auto on 16 Aug 2007 22:40
The entry "2oggA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 16 Aug 2007 22:40
The entry "2oggA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 16 Aug 2007 17:34
Giving up on SSAP job SID4867432700479008 because submission time of Tue Aug 14 09:14:41 2007 is more than 172800 seconds older than current time (Thu Aug 16 17:34:54 2007).
Update comment by auto on 14 Aug 2007 10:41
SSAP job SID4867432700479008 is not yet finished.
Ssap cath submit by auto on 14 Aug 2007 09:14
The entry "2oggA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 14 Aug 2007 09:14
The entry "2oggA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 14 Aug 2007 07:15
Retrieved PRC results for job ID SID4927060670521320 and inserted them into the database.
Domain scan prc cath by auto on 14 Aug 2007 07:14
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 4 results for 2oggA01
Flow stage update by auto on 13 Aug 2007 10:49
The entry "2oggA01" has been submitted to the PRC webservice.
Prc cath submit by auto on 13 Aug 2007 10:49
The entry "2oggA01" has been submitted to the PRC webservice.
Flow stage update by auto on 13 Aug 2007 08:53
Retrieved HMM(SAM) results for job ID SID8591561038177984 and inserted them into the database.
Domain scan sam cath by auto on 13 Aug 2007 08:52
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 4 results for 2oggA01
Update comment by auto on 12 Aug 2007 13:14
HMM(SAM) job SID8591561038177984 is not yet finished.
Sam cath submit by auto on 12 Aug 2007 12:00
The entry "2oggA01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 12 Aug 2007 12:00
The entry "2oggA01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 12 Aug 2007 05:13
Retrieved "2oggA01" CATHEDRAL results for job ID SID1734536185215392 and inserted them into the database.
Domain scan cathedral cath by auto on 12 Aug 2007 05:12
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 345 results for 2oggA01
Update comment by auto on 11 Aug 2007 06:02
"2oggA01" CATHEDRAL job SID1734536185215392 is not yet finished.
Flow stage update by auto on 11 Aug 2007 04:33
The entry "2oggA01" has been submitted to the CATHEDRAL webservice.
Cathedral cath submit by auto on 11 Aug 2007 04:33
The entry "2oggA01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 11 Aug 2007 02:41
ScanList with 9778 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2oggA01.scanlist" for "2oggA01"
Write scan list by auto on 11 Aug 2007 02:41
Writing ScanList containing 9778 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2oggA01.scanlist" for domain "2oggA01"
Update comment by auto on 10 Aug 2007 14:33
Waiting for 984 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Update comment by auto on 10 Aug 2007 10:32
Waiting for 1052 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Update comment by auto on 10 Aug 2007 06:46
Waiting for 1095 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Update comment by auto on 10 Aug 2007 02:47
Waiting for 1146 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Update comment by auto on 09 Aug 2007 22:33
Waiting for 1198 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Update comment by auto on 09 Aug 2007 19:15
Waiting for 1261 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Update comment by auto on 09 Aug 2007 14:59
Waiting for 1336 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Update comment by auto on 09 Aug 2007 10:59
Waiting for 1377 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Update comment by auto on 09 Aug 2007 06:45
Waiting for 1412 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Update comment by auto on 09 Aug 2007 02:52
Waiting for 1457 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Update comment by auto on 08 Aug 2007 22:35
Waiting for 1505 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Update comment by auto on 08 Aug 2007 18:43
Waiting for 1577 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Update comment by auto on 08 Aug 2007 14:43
Waiting for 1645 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Update comment by auto on 08 Aug 2007 11:06
Waiting for 1704 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Update comment by auto on 08 Aug 2007 06:52
Waiting for 1742 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Update comment by auto on 08 Aug 2007 02:58
Waiting for 1792 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Update comment by auto on 07 Aug 2007 22:47
Waiting for 1837 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Update comment by auto on 07 Aug 2007 19:34
Waiting for 1893 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Update comment by auto on 07 Aug 2007 15:15
Waiting for 1975 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Update comment by auto on 07 Aug 2007 10:45
Waiting for 2056 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Update comment by auto on 07 Aug 2007 06:57
Waiting for 2116 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Update comment by auto on 07 Aug 2007 02:51
Waiting for 2178 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Update comment by auto on 06 Aug 2007 22:38
Waiting for 2230 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Update comment by auto on 06 Aug 2007 18:51
Waiting for 2293 new domains (example : 1t6pD03) to be processed so that they can be scanned against too.
Update comment by auto on 06 Aug 2007 14:45
Waiting for 2348 new domains (example : 1rqrB02) to be processed so that they can be scanned against too.
Update comment by auto on 06 Aug 2007 11:23
Waiting for 2404 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 06 Aug 2007 09:19
Waiting for 2415 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 06 Aug 2007 02:16
Waiting for 2528 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 05 Aug 2007 19:05
Waiting for 2652 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 05 Aug 2007 07:24
Waiting for 2828 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 05 Aug 2007 03:15
Waiting for 2883 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 04 Aug 2007 22:52
Waiting for 2924 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 04 Aug 2007 19:08
Waiting for 2965 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 04 Aug 2007 15:12
Waiting for 3034 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 04 Aug 2007 11:11
Waiting for 3098 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 04 Aug 2007 07:01
Waiting for 3152 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 04 Aug 2007 03:10
Waiting for 3197 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Aug 2007 22:58
Waiting for 3216 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Aug 2007 19:54
Waiting for 3206 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Aug 2007 15:51
Waiting for 3198 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Aug 2007 11:02
Waiting for 3055 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Aug 2007 07:05
Waiting for 3126 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Aug 2007 03:03
Waiting for 3204 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Aug 2007 22:48
Waiting for 3254 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Aug 2007 19:32
Waiting for 3282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Aug 2007 15:26
Waiting for 3339 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Aug 2007 11:07
Waiting for 3395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Flow stage update by auto on 02 Aug 2007 10:38
No satisfactory AssignClose result found.
Flow stage update by auto on 02 Aug 2007 10:35
No in_process hits for Domain "2oggA01" ready to be processed
Flow stage update by auto on 02 Aug 2007 10:34
NW result present for Domain "2oggA01"
Flow stage update by auto on 12 Jul 2007 02:02
All required files are present for Domain "2oggA01"
Flow stage update by auto on 11 Jul 2007 16:04
Beginning processing for Domain "2oggA01"
Insertion by cuff on 11 Jul 2007 14:57
nice chopping
