Domain assigned by auto on 14 Feb 2008 17:26
Assigning to "3.30.390.10" based on similarity with "2og9B01"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2og9A01 | 11 | 135 |
| 2og9A01 | 369 | 385 |
| 2og9A02 | 136 | 368 |
There are 17 matching structural neighberhood comparisons for CATH ID 3.30.390.10.9.1.1.1.1 (SIMAX score < 5)
>pdb|2og9A01 PSDRITWVRISSCYLPLATPITEIAILFAEIETAGGHQGLGFSYSKRAGGPGQFAHAREIAPALIGEDPSDIAKLWDKLC WAGASAGRSGLSTQAIGAFDVALWDLKAKRAGGQVKAWTREEAQVGTRP
Assigning to "3.30.390.10" based on similarity with "2og9B01"
No in_process hits for Domain "2og9A01" ready to be processed
Domain "2og9A01" hits Domain "2og9B01" (98.75% over 100%) which is currently in process
Domain "2og9A01" hits Domain "2og9B01" (98.75% over 100%) which is currently in process
Domain "2og9A01" hits Domain "2og9B01" (98.75% over 100%) which is currently in process
Domain "2og9A01" hits Domain "2og9B01" (98.75% over 100%) which is currently in process
Domain "2og9A01" hits Domain "2og9B01" (98.75% over 100%) which is currently in process
Domain "2og9A01" hits Domain "2og9B01" (98.75% over 100%) which is currently in process
NW result present for Domain "2og9A01"
All required files are present for Domain "2og9A01"
Beginning processing for Domain "2og9A01"
nice chopping