CATH Domain: 2og9A01 XML data for domain: 2og9A01

Molscript image for 2og9A01
2og9A01
PDB coordinates for domain 2og9A01

PDB 2og9, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.390 Enolase-like; domain 1
3.30.390.10 Enolase-like, N-terminal domain Gene3D
3.30.390.10.9
3.30.390.10.9.1
3.30.390.10.9.1.1
3.30.390.10.9.1.1.1
3.30.390.10.9.1.1.1.1

Segment boundaries for domain 2og9A01

Chopping figure for domain 2og9A01
DomainStart PDB ResidueStop PDB Residue
2og9A01 11 135
2og9A01 369 385
2og9A02 136 368

Structural Neighbourhood (17 entries)

There are 17 matching structural neighberhood comparisons for CATH ID 3.30.390.10.9.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 17 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2ovlA01 90.69 Toluene and xylene degradationStreptomyces coelicolorMandelate racemase [EC:5.1.2.2]Benzoate degradation via hydroxylationPutative racemase 3.30.390.10 123 31 89 1.44 1.60
1mdlA01 88.63 Mandelate racemasePseudomonas putida 3.30.390.10 126 19 90 1.80 1.98
3fv9D01 88.46 Mandelate racemase/muconate lactonizing enzyme, putativeRoseovarius nubinhibens ISM 3.30.390.10 130 24 89 1.86 2.08
1nu5A01 87.69 Chloromuconate cycloisomerasePseudomonas sp. P51 3.30.390.10 116 20 79 1.36 1.72
3go2A01 87.66 Burkholderia xenovorans LB400Putative uncharacterized protein 3.30.390.10 114 21 84 1.79 2.12
1ec7C01 86.95 Ascorbate and aldarate metabolismD-glucarate catabolic processGlucarate dehydratase activityGlucarate dehydrataseGlucarate dehydratase [EC:4.2.1.40] 3.30.390.10 136 12 81 1.91 2.34
3bjsA01 86.60 Polaromonas sp. JS666Mandelate racemase/muconate lactonizing enzyme 3.30.390.10 116 22 82 2.17 2.62
2qq6B01 86.53 Rubrobacter xylanophilus DSM 9941Mandelate racemase/muconate lactonizing enzyme-like protein 3.30.390.10 115 24 81 2.25 2.76
1tkkA01 85.85 Bacillus subtilisL-Ala-D/L-Glu epimerase 3.30.390.10 115 16 79 2.11 2.64
2qgyB01 85.10 3.30.390.10 135 15 91 2.60 2.85
1tzzB01 84.35 Bradyrhizobium japonicumBll6730 protein 3.30.390.10 119 26 79 2.59 3.24
2oqyA01 84.30 Muconate cycloisomeraseOceanobacillus iheyensis 3.30.390.10 142 16 81 2.85 3.49
2zadA01 84.02 Thermotoga maritimaL-Ala-D/L-Glu epimerase 3.30.390.10 109 16 76 2.22 2.89
1rvkA01 83.92 Agrobacterium tumefaciens str. C58Isomerase/lactonizing enzyme 3.30.390.10 115 20 78 2.99 3.82
1jpdX01 83.84 Racemase and epimerase activity, acting on amino acids and derivativesL-Ala-D/L-Glu epimeraseEscherichia coli K-12 3.30.390.10 99 27 73 2.27 3.08
2pgwA01 83.52 Sinorhizobium melilotiToluene and xylene degradationBenzoate degradation via hydroxylationMuconate cycloisomerase [EC:5.5.1.1]Mandelate racemase/muconate lactonizing enzyme family protein 3.30.390.10 147 25 80 3.18 3.93
2nqlA01 83.09 Agrobacterium tumefaciens str. C58Isomerase/lactonizing enzyme 3.30.390.10 162 21 73 2.49 3.39
Displaying entries 1 to 17 (page 1 of 1)


Domain ATOM Sequence

>pdb|2og9A01
PSDRITWVRISSCYLPLATPITEIAILFAEIETAGGHQGLGFSYSKRAGGPGQFAHAREIAPALIGEDPSDIAKLWDKLC
WAGASAGRSGLSTQAIGAFDVALWDLKAKRAGGQVKAWTREEAQVGTRP    

Domain COMBS Sequence

>pdb|2og9A01
XSLKTTTSSTPSDRITWVRISSCYLPLATPISDAKVLTGRQKPXTEIAILFAEIETAGGHQGLGFSYSKRAGGPGQFAHA
REIAPALIGEDPSDIAKLWDKLCWAGASAGRSGLSTQAIGAFDVALWDLKAKRAGGQVKAWTREEAQVGTRPEGHHHHHH    

Domain History Events (12)

Domain assigned by auto on 14 Feb 2008 17:26

Assigning to "3.30.390.10" based on similarity with "2og9B01"

Flow stage update by auto on 14 Feb 2008 17:10

No in_process hits for Domain "2og9A01" ready to be processed

Update comment by auto on 03 Sep 2007 20:10

Domain "2og9A01" hits Domain "2og9B01" (98.75% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2og9A01" hits Domain "2og9B01" (98.75% over 100%) which is currently in process

Update comment by auto on 11 Aug 2007 14:42

Domain "2og9A01" hits Domain "2og9B01" (98.75% over 100%) which is currently in process

Update comment by auto on 10 Aug 2007 23:26

Domain "2og9A01" hits Domain "2og9B01" (98.75% over 100%) which is currently in process

Update comment by auto on 02 Aug 2007 10:38

Domain "2og9A01" hits Domain "2og9B01" (98.75% over 100%) which is currently in process

Flow stage update by auto on 02 Aug 2007 10:35

Domain "2og9A01" hits Domain "2og9B01" (98.75% over 100%) which is currently in process

Flow stage update by auto on 02 Aug 2007 10:34

NW result present for Domain "2og9A01"

Flow stage update by auto on 12 Jul 2007 02:02

All required files are present for Domain "2og9A01"

Flow stage update by auto on 11 Jul 2007 16:04

Beginning processing for Domain "2og9A01"

Insertion by cuff on 11 Jul 2007 16:02

nice chopping