CATH Domain: 2odfD01 XML data for domain: 2odfD01

Molscript image for 2odfD01
2odfD01
PDB coordinates for domain 2odfD01

PDB 2odf, Chain D, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.630 Aminopeptidase
3.40.630.40 Zn-dependent exopeptidases Gene3D
3.40.630.40.1
3.40.630.40.1.1
3.40.630.40.1.1.1
3.40.630.40.1.1.1.1
3.40.630.40.1.1.1.1.3

[top]
Segment boundaries for domain 2odfD01

Chopping figure for domain 2odfD01
DomainStart PDB ResidueStop PDB Residue
2odfD01 15 256

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.40.630.40.1.1.1.1.3 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2q7sA00 81.07 Ralstonia eutropha JMP134N-formylglutamate amidohydrolase 3.40.630.40 266 17 84 2.99 3.53
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2odfD01
AVGVENAAAKGDVLLVCEHASATIPQKYGTLGLSADVLSSHAAWDPGALAVARLLSEKFHATLVYQRFSRLVYDCNRPPE
SPSAMPVKSEIYDIPGNFDLDEAERFARTSALYVPFHDRVSEIIAERQAAGRKVVVVTIHSFTPVYHGRFREVEIGILHD
NDSRLADAMLAGAEGASLTVRRNDPYGPEDGVTHTLRLHALPDGLLNVMIEIRNDLIANEGEQAAIAGFLHELMGKALSS
IE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2odfD01
AVGVENAAAKGDVLLVCEHASATIPQKYGTLGLSADVLSSHAAWDPGALAVARLLSEKFHATLVYQRFSRLVYDCNRPPE
SPSAMPVKSEIYDIPGNFDLDEAERFARTSALYVPFHDRVSEIIAERQAAGRKVVVVTIHSFTPVYHGRFREVEIGILHD
NDSRLADAMLAGAEGASLTVRRNDPYGPEDGVTHTLRLHALPDGLLNVMIEIRNDLIANEGEQAAIAGFLHELMGKALSS
IEE
BLAST against CATH

[top]
Domain History Events (10)

Domain assigned by auto on 14 Apr 2008 17:15

Assigning to "3.40.630.40" based on similarity with "2odfE01"

Flow stage update by auto on 14 Apr 2008 17:05

No in_process hits for Domain "2odfD01" ready to be processed

Update comment by auto on 03 Sep 2007 20:10

Domain "2odfD01" hits Domain "2odfE01" (100% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2odfD01" hits Domain "2odfE01" (100% over 100%) which is currently in process

Update comment by auto on 27 Aug 2007 22:06

Domain "2odfD01" hits Domain "2odfE01" (100% over 100%) which is currently in process

Flow stage update by auto on 27 Aug 2007 22:05

Domain "2odfD01" hits Domain "2odfE01" (100% over 100%) which is currently in process

Flow stage update by auto on 27 Aug 2007 22:05

NW result present for Domain "2odfD01"

Flow stage update by auto on 19 Aug 2007 10:12

All required files are present for Domain "2odfD01"

Flow stage update by auto on 16 Aug 2007 17:14

Beginning processing for Domain "2odfD01"

Insertion by auto on 16 Aug 2007 14:59

Final ChopClose added based on similarity with "2odfC"