CATH Domain: 2oc5A01 XML data for domain: 2oc5A01

Molscript image for 2oc5A01
2oc5A01
PDB coordinates for domain 2oc5A01

PDB 2oc5, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1260 Ferritin;
1.20.1260.10 Gene3D
1.20.1260.10.24
1.20.1260.10.24.1
1.20.1260.10.24.1.1
1.20.1260.10.24.1.1.1
1.20.1260.10.24.1.1.1.1

[top]
Segment boundaries for domain 2oc5A01

Chopping figure for domain 2oc5A01
DomainStart PDB ResidueStop PDB Residue
2oc5A01 27 241

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 1.20.1260.10.24.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1otkA00 78.24 Phenylacetic acid degradation protein paaCPhenylacetic acid degradation proteinEscherichia coli K-12 1.20.1260.10 244 9 76 3.34 4.38
2yw6B00 77.60 Mycobacterium smegmatisDNA protection during starvation proteinStarvation-inducible DNA-binding protein 1.20.1260.10 150 8 65 3.18 4.85
2rccA01 75.49 Pyrimidine metabolismRibonucleoside-diphosphate reductase beta chain [EC:1.17.4.1]Purine metabolismRibonucleoside-diphosphate reductase subunit betaBacillus halodurans 1.10.620.20 240 8 77 3.45 4.43
2incB00 74.99 Toluene, o-xylene monooxygenase oxygenase subunitPseudomonas stutzeri 1.10.620.20 322 13 57 2.76 4.83
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2oc5A01
SDRYKDAYSRINAIVIEGEQEAHDNYIAIGTLLPDHVEELKRLAKERHKKGFTACGKNLGVEADDFAREFFAPLRDNFQT
ALGQGKTPTCLLIQALLIEAFAISAYHTYIPVSDPFARKITEGVVKDEYTHLNYGEAWLKANLESCREELLEANRENLPL
IRRLDQVAGDAAVLQDKEDLIEDFLIAYQESLTEIGFNTREITRAAAAL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2oc5A01
SDRYKDAYSRINAIVIEGEQEAHDNYIAIGTLLPDHVEELKRLAKXEXRHKKGFTACGKNLGVEADXDFAREFFAPLRDN
FQTALGQGKTPTCLLIQALLIEAFAISAYHTYIPVSDPFARKITEGVVKDEYTHLNYGEAWLKANLESCREELLEANREN
LPLIRRXLDQVAGDAAVLQXDKEDLIEDFLIAYQESLTEIGFNTREITRXAAAALVS
BLAST against CATH

[top]
Domain History Events (98)

Domain assigned by cuff on 09 Mar 2008 10:58

same superfamily

Domain assignment manual match h by cuff on 09 Mar 2008 10:57

same superfamily in scop

Domain assignment manual match t by rupa on 05 Sep 2007 12:04

Previously matched with a TBA, but should fit into this fold.

Homcheck review by rupa on 05 Sep 2007 12:04

Previously matched with a TBA, but should fit into this fold.

Flow stage update by rupa on 05 Sep 2007 12:04

Previously matched with a TBA, but should fit into this fold.

Domain assignment manual match h by rupa on 21 Aug 2007 11:37

Excellent cathedral and ssap scores, same folding/topology, different pfam class. Score high enough for homology.

Homcheck allotment by rupa on 21 Aug 2007 11:34

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by rupa on 21 Aug 2007 11:34

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 21 Aug 2007 00:11

Domain "2oc5A01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 21 Aug 2007 00:10

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2oc5A01

Flow stage update by auto on 20 Aug 2007 23:57

Retrieved PRC_PFAMCATH results for job ID SID0121584419890337 and results inserted.

Domain scan prc pfamcath by auto on 20 Aug 2007 23:56

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2oc5A01

Update comment by auto on 20 Aug 2007 19:02

PRC_PFAMCATH job SID0121584419890337 is not yet finished.

Prc pfamcath submit by auto on 20 Aug 2007 18:58

The entry "2oc5A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 20 Aug 2007 18:58

The entry "2oc5A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 20 Aug 2007 17:48

Retrieved SSAP results for job ID SID4091475918463080 and chopping inserted.

Domain scan ssap cath by auto on 20 Aug 2007 17:46

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 517 results for 2oc5A01

Update comment by auto on 19 Aug 2007 07:42

SSAP job SID4091475918463080 is not yet finished.

Flow stage update by auto on 19 Aug 2007 06:38

The entry "2oc5A01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 19 Aug 2007 06:38

The entry "2oc5A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 19 Aug 2007 02:35

Giving up on SSAP job SID9698071131033182 because submission time of Thu Aug 16 22:39:45 2007 is more than 172800 seconds older than current time (Sun Aug 19 02:35:53 2007).

Update comment by auto on 16 Aug 2007 23:44

SSAP job SID9698071131033182 is not yet finished.

Ssap cath submit by auto on 16 Aug 2007 22:39

The entry "2oc5A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 22:39

The entry "2oc5A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 17:33

Giving up on SSAP job SID9475222183134984 because submission time of Tue Aug 14 09:11:34 2007 is more than 172800 seconds older than current time (Thu Aug 16 17:33:45 2007).

Update comment by auto on 14 Aug 2007 10:40

SSAP job SID9475222183134984 is not yet finished.

Flow stage update by auto on 14 Aug 2007 09:11

The entry "2oc5A01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 14 Aug 2007 09:11

The entry "2oc5A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 07:01

Retrieved PRC results for job ID SID9101621720867904 and inserted them into the database.

Domain scan prc cath by auto on 14 Aug 2007 07:01

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2oc5A01

Flow stage update by auto on 13 Aug 2007 10:46

The entry "2oc5A01" has been submitted to the PRC webservice.

Prc cath submit by auto on 13 Aug 2007 10:46

The entry "2oc5A01" has been submitted to the PRC webservice.

Flow stage update by auto on 13 Aug 2007 08:39

Retrieved HMM(SAM) results for job ID SID0579293133561840 and inserted them into the database.

Domain scan sam cath by auto on 13 Aug 2007 08:39

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2oc5A01

Update comment by auto on 12 Aug 2007 13:12

HMM(SAM) job SID0579293133561840 is not yet finished.

Sam cath submit by auto on 12 Aug 2007 11:58

The entry "2oc5A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 11:58

The entry "2oc5A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 04:52

Retrieved "2oc5A01" CATHEDRAL results for job ID SID7894735371966208 and inserted them into the database.

Domain scan cathedral cath by auto on 12 Aug 2007 04:51

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 47 results for 2oc5A01

Update comment by auto on 11 Aug 2007 06:00

"2oc5A01" CATHEDRAL job SID7894735371966208 is not yet finished.

Flow stage update by auto on 11 Aug 2007 04:30

The entry "2oc5A01" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 11 Aug 2007 04:30

The entry "2oc5A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 11 Aug 2007 02:37

ScanList with 9778 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2oc5A01.scanlist" for "2oc5A01"

Write scan list by auto on 11 Aug 2007 02:36

Writing ScanList containing 9778 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2oc5A01.scanlist" for domain "2oc5A01"

Update comment by auto on 10 Aug 2007 14:33

Waiting for 984 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 10:32

Waiting for 1052 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 06:46

Waiting for 1095 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 02:47

Waiting for 1146 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 22:33

Waiting for 1198 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 19:14

Waiting for 1261 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 14:59

Waiting for 1336 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 10:58

Waiting for 1377 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 06:45

Waiting for 1412 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 02:52

Waiting for 1457 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 22:35

Waiting for 1505 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 18:43

Waiting for 1577 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 14:43

Waiting for 1645 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 11:05

Waiting for 1704 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 06:51

Waiting for 1742 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 02:58

Waiting for 1792 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 22:46

Waiting for 1837 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 19:33

Waiting for 1893 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 15:15

Waiting for 1975 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 10:44

Waiting for 2056 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 06:57

Waiting for 2116 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 02:50

Waiting for 2178 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 22:38

Waiting for 2230 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 18:50

Waiting for 2293 new domains (example : 1t6pD03) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 14:44

Waiting for 2348 new domains (example : 1rqrB02) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 11:22

Waiting for 2404 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 09:18

Waiting for 2415 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 02:16

Waiting for 2528 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 19:05

Waiting for 2652 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 07:23

Waiting for 2828 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 03:14

Waiting for 2883 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 22:51

Waiting for 2924 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 19:08

Waiting for 2965 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 15:11

Waiting for 3034 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 11:11

Waiting for 3098 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 07:01

Waiting for 3152 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 03:10

Waiting for 3197 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 22:57

Waiting for 3216 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 19:53

Waiting for 3206 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 15:50

Waiting for 3198 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 11:02

Waiting for 3055 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 07:04

Waiting for 3126 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 03:03

Waiting for 3204 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 22:48

Waiting for 3254 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 19:32

Waiting for 3282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 15:26

Waiting for 3339 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 11:07

Waiting for 3395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 07:06

Waiting for 3471 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Flow stage update by auto on 02 Aug 2007 06:38

No satisfactory AssignClose result found.

Flow stage update by auto on 02 Aug 2007 06:35

No in_process hits for Domain "2oc5A01" ready to be processed

Flow stage update by auto on 02 Aug 2007 06:35

NW result present for Domain "2oc5A01"

Flow stage update by auto on 12 Jul 2007 02:02

All required files are present for Domain "2oc5A01"

Flow stage update by auto on 11 Jul 2007 16:04

Beginning processing for Domain "2oc5A01"

Insertion by cuff on 11 Jul 2007 14:58

nice chopping