CATH Domain: 2obxA00 XML data for domain: 2obxA00

Molscript image for 2obxA00
2obxA00
PDB coordinates for domain 2obxA00

PDB 2obx, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.960 Gene3D
3.40.50.960.4
3.40.50.960.4.1
3.40.50.960.4.1.1
3.40.50.960.4.1.1.1
3.40.50.960.4.1.1.1.1

[top]
Segment boundaries for domain 2obxA00

Chopping figure for domain 2obxA00
DomainStart PDB ResidueStop PDB Residue
2obxA00 6 155

Structural Neighbourhood (8 entries)

There are 8 matching structural neighberhood comparisons for CATH ID 3.40.50.960.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 8 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1c41A00 88.02 Riboflavin metabolismRiboflavin synthase beta chain [EC:2.5.1.-]Magnaporthe griseaMetabolic pathways6,7-dimethyl-8-ribityllumazine synthase 3.40.50.960 165 26 86 3.30 3.81
2q5cA01 80.33 Clostridium acetobutylicumNtrC family transcriptional regulator (PAS and AAA domains) 3.40.50.2300 97 13 64 2.46 3.80
1bykA01 80.12 Specific transcriptional repressor activityLacI family transcriptional regulator, trehalose operon repressorSequence-specific DNA binding transcription factor activityTranscriptionHTH-type transcriptional regulator treR 3.40.50.2300 138 5 78 3.70 4.70
3cwcB01 78.03 Glycerate kinase [EC:2.7.1.31]Glycerolipid metabolismSalmonella enterica subsp. enterica serovar TyphimuriumPutative glycerate kinase 2Glycine, serine and threonine metabolism 3.40.50.10350 137 8 80 3.74 4.67
1kjnA00 77.87 Methanothermobacter thermautotrophicus str. Delta HConserved protein 3.40.50.10160 148 8 72 3.49 4.85
1edzA02 77.87 One carbon pool by folateIdentical protein bindingMethylenetetrahydrofolate dehydrogenase (NAD+) [EC:1.5.1.15]Purine base biosynthetic processMethylenetetrahydrofolate dehydrogenase (NAD+) activity 3.40.192.10 131 4 71 2.71 3.80
2pjuC01 75.97 Positive regulation of gene-specific transcriptionPropionate catabolism operon regulatory proteinNegative regulation of gene-specific transcriptionEscherichia coli K-12Specific transcriptional repressor activity 3.40.50.2300 100 11 66 3.08 4.62
1di6A00 74.45 Molybdopterin adenylyltransferaseMolybdopterin biosynthesis protein MogEscherichia coli K-12 3.40.980.10 183 12 63 3.07 4.80
[1]
Displaying entries 1 to 8 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2obxA00
HKDYETVRIAVVRARWHADIVDQCVSAFEAEMADIGGDRFAVDVFDVPGAYEIPLHARTLAETGRYGAVLGTAFVVNGGI
YRHEFVASAVIDGMMNVQLSTGVPVLSAVLTPHNYHDSAEHHRFFFEHFTVKGKEAARACVEILAAREKI
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2obxA00
MNQHSHKDYETVRIAVVRARWHADIVDQCVSAFEAEMADIGGDRFAVDVFDVPGAYEIPLHARTLAETGRYGAVLGTAFV
VNGGIYRHEFVASAVIDGMMNVQLSTGVPVLSAVLTPHNYHDSAEHHRFFFEHFTVKGKEAARACVEILAAREKIAA
BLAST against CATH

[top]
Domain History Events (10)

Domain assigned by auto on 27 Nov 2007 02:58

Assigning to "3.40.50.960" based on similarity with "2obxD00"

Flow stage update by auto on 27 Nov 2007 02:56

No in_process hits for Domain "2obxA00" ready to be processed

Update comment by auto on 27 Nov 2007 02:52

Domain "2obxA00" hits Domain "2obxB00" (100% over 100%) which is currently in process

Update comment by auto on 27 Nov 2007 02:48

Domain "2obxA00" hits Domain "2obxD00" (100% over 100%) which is currently in process

Update comment by auto on 27 Nov 2007 02:37

Domain "2obxA00" hits Domain "2obxC00" (100% over 100%) which is currently in process

Flow stage update by auto on 27 Nov 2007 02:25

Domain "2obxA00" hits Domain "2obxC00" (100% over 100%) which is currently in process

Flow stage update by auto on 27 Nov 2007 02:25

NW result present for Domain "2obxA00"

Flow stage update by auto on 24 Nov 2007 14:38

All required files are present for Domain "2obxA00"

Flow stage update by auto on 24 Nov 2007 02:36

Beginning processing for Domain "2obxA00"

Insertion by auto on 23 Nov 2007 18:43

Final ChopClose added based on similarity with "2obxC"