Domain assigned by auto on 14 Feb 2008 14:01
Assigning to "1.10.10.10" based on similarity with "2obpB00"
There are 113 matching structural neighberhood comparisons for CATH ID 1.10.10.10.8.1.1.1.1 (SIMAX score < 5)
>pdb|2obpA00 GIDPAIVEVLLVLREAGIENGATPWSLPKIAKRAQLPSVLRRVLTQLQAAGLADVSVEADGRGHASLTQEGAALAAQLFP
Assigning to "1.10.10.10" based on similarity with "2obpB00"
No in_process hits for Domain "2obpA00" ready to be processed
Domain "2obpA00" hits Domain "2obpB00" (97.9166666666667% over 100%) which is currently in process
Domain "2obpA00" hits Domain "2obpB00" (97.9166666666667% over 100%) which is currently in process
Domain "2obpA00" hits Domain "2obpB00" (97.9166666666667% over 100%) which is currently in process
Domain "2obpA00" hits Domain "2obpB00" (97.9166666666667% over 100%) which is currently in process
Domain "2obpA00" hits Domain "2obpB00" (97.9166666666667% over 100%) which is currently in process
Domain "2obpA00" hits Domain "2obpB00" (97.9166666666667% over 100%) which is currently in process
NW result present for Domain "2obpA00"
All required files are present for Domain "2obpA00"
Beginning processing for Domain "2obpA00"
nice chopping