CATH Domain: 2ob4A00 XML data for domain: 2ob4A00

Molscript image for 2ob4A00
2ob4A00
PDB coordinates for domain 2ob4A00

PDB 2ob4, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.110 Ubiquitin Conjugating Enzyme
3.10.110.10 Ubiquitin Conjugating Enzyme Gene3D
3.10.110.10.6
3.10.110.10.6.2
3.10.110.10.6.2.1
3.10.110.10.6.2.1.1
3.10.110.10.6.2.1.1.1

[top]
Segment boundaries for domain 2ob4A00

Chopping figure for domain 2ob4A00
DomainStart PDB ResidueStop PDB Residue
2ob4A00 9 181

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.10.110.10.6.2.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2e2cA00 88.49 Ubiquitin-conjugating enzyme E2 CSpisula solidissima 3.10.110.10 156 33 90 2.39 2.63
1br7003 85.95 3.10.110.10 117 41 71 1.30 1.82
1wzvA00 85.58 Parkinson's diseaseUbiquitin-conjugating enzyme E2 L6 [EC:6.3.2.19]Homo sapiensUbiquitin mediated proteolysisProtein binding 3.10.110.10 150 24 90 2.11 2.34
1s1qA00 78.82 EndocytosisMultivesicular bodyPlasma membraneNucleolusTumor susceptibility gene 101 protein 3.10.110.10 137 10 69 3.37 4.85
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2ob4A00
SQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPYSPPAFRFLTKMWHPNIYE
TGDVCISILHPPVQNVRTILLSVISLLNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDGV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2ob4A00
GSPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPYSPPAFRFLTKMWHP
NIYETGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMYRKWKESKGKDREYTDI
IRKQVLGTKVDAERDGVKVP
BLAST against CATH

[top]
Domain History Events (11)

Domain assigned by auto on 28 Jun 2007 14:05

Assigning to "3.10.110.10" based on similarity with "2cyxA01"

Flow stage update by auto on 28 Jun 2007 14:04

No in_process hits for Domain "2ob4A00" ready to be processed

Update comment by auto on 28 Jun 2007 10:01

Domain "2ob4A00" hits Domain "2o25D00" (36.875% over 85.5555555555556%) which is currently in process

Update comment by auto on 28 Jun 2007 06:05

Domain "2ob4A00" hits Domain "2o25C00" (36.875% over 85.5555555555556%) which is currently in process

Update comment by auto on 28 Jun 2007 02:05

Domain "2ob4A00" hits Domain "2cyxA01" (48.4848484848485% over 91.6666666666667%) which is currently in process

Update comment by auto on 27 Jun 2007 22:03

Domain "2ob4A00" hits Domain "2cyxB01" (48.4848484848485% over 91.6666666666667%) which is currently in process

Flow stage update by auto on 27 Jun 2007 22:02

Domain "2ob4A00" hits Domain "2cyxB01" (48.4848484848485% over 91.6666666666667%) which is currently in process

Flow stage update by auto on 27 Jun 2007 22:02

NW result present for Domain "2ob4A00"

Flow stage update by auto on 27 Jun 2007 18:23

All required files are present for Domain "2ob4A00"

Flow stage update by auto on 27 Jun 2007 14:11

Beginning processing for Domain "2ob4A00"

Insertion by auto on 27 Jun 2007 14:07

Final ChopClose added based on similarity with "1pzvA"