Domain assigned by cuff on 14 Apr 2008 15:37
same superfamily
CATH Domain: 2oasA01
2oasA01
PDB 2oas, Chain A, Domain 1
Segment boundaries for domain 2oasA01
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2oasA01 | 2 | 179 |
| 2oasA02 | 180 | 283 |
| 2oasA03 | 285 | 428 |
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|2oasA01 PAIVCQSALEAVSLIRSGETLWTHSGATPKVLLDALAKHALTLDNITLLQLHTEGAESLSHPSLLGHLRHRCFFGGVPTR PLLQSGDADYVPIFLSEVPKLFRSGEQKIDTAIIQVSPPDKHGCSLGISVEATLAACQVAGKIIAHINPQPRTHGDGFIH IDRFAAVYEQSASLP
Domain History Events (74)
Domain assignment manual match h by cuff on 14 Apr 2008 15:36
nice structural match - just some emblishment present but fold basically the same. very similar in terms of function. Some pfam evidence of function.
Domain assignment manual match a by tronnberg on 12 Sep 2007 12:20
SSAP: 77.03 OV: 76 SEQ: 12. Reasonable similar overal structure, but have quite different linkage and a few secondary structures differ. None of the matches with a SSAP value above 70 has the same function as the query.
Homcheck review by tronnberg on 12 Sep 2007 12:20
SSAP: 77.03 OV: 76 SEQ: 12. Reasonable similar overal structure, but have quite different linkage and a few secondary structures differ. None of the matches with a SSAP value above 70 has the same function as the query.
Flow stage update by tronnberg on 12 Sep 2007 12:20
SSAP: 77.03 OV: 76 SEQ: 12. Reasonable similar overal structure, but have quite different linkage and a few secondary structures differ. None of the matches with a SSAP value above 70 has the same function as the query.
Homcheck allotment by tronnberg on 12 Sep 2007 12:12
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by tronnberg on 12 Sep 2007 12:12
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 11 Sep 2007 20:06
Domain "2oasA01" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 11 Sep 2007 20:06
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2oasA01
Flow stage update by auto on 11 Sep 2007 19:31
Retrieved PRC_PFAMCATH results for job ID SID2539654076230560 and results inserted.
Domain scan prc pfamcath by auto on 11 Sep 2007 19:30
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 4 results for 2oasA01
Update comment by auto on 11 Sep 2007 15:58
PRC_PFAMCATH job SID2539654076230560 is not yet finished.
Prc pfamcath submit by auto on 11 Sep 2007 15:51
The entry "2oasA01" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 11 Sep 2007 15:51
The entry "2oasA01" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 11 Sep 2007 14:44
Retrieved SSAP results for job ID SID8352487170579488 and results inserted.
Domain scan ssap cath by auto on 11 Sep 2007 14:43
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1352 results for 2oasA01
Update comment by auto on 09 Sep 2007 23:02
SSAP job SID8352487170579488 is not yet finished.
Ssap cath submit by auto on 09 Sep 2007 22:17
The entry "2oasA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 22:17
The entry "2oasA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 19:51
Giving up on SSAP job SID6883403005768304 because submission time of Wed Sep 5 16:08:52 2007 is more than 345600 seconds older than current time (Sun Sep 9 19:51:07 2007).
Update comment by auto on 05 Sep 2007 19:35
SSAP job SID6883403005768304 is not yet finished.
Ssap cath submit by auto on 05 Sep 2007 16:08
The entry "2oasA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 16:08
The entry "2oasA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 09:06
Retrieved PRC results for job ID SID3419028542151376 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 09:05
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 5 results for 2oasA01
Prc cath submit by auto on 05 Sep 2007 03:47
The entry "2oasA01" has been submitted to the PRC webservice.
Flow stage update by auto on 05 Sep 2007 03:47
The entry "2oasA01" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Sep 2007 22:27
Retrieved HMM(SAM) results for job ID SID7937195859451472 and inserted them into the database.
Domain scan sam cath by auto on 04 Sep 2007 22:26
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 2oasA01
Update comment by auto on 04 Sep 2007 11:49
HMM(SAM) job SID7937195859451472 is not yet finished.
Sam cath submit by auto on 04 Sep 2007 09:57
The entry "2oasA01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 09:57
The entry "2oasA01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 01:48
Retrieved "2oasA01" CATHEDRAL results for job ID SID3911098293791372 and inserted them into the database.
Domain scan cathedral cath by auto on 04 Sep 2007 01:46
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 453 results for 2oasA01
Cathedral cath submit by auto on 03 Sep 2007 14:03
The entry "2oasA01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 14:03
The entry "2oasA01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 12:03
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2oasA01.scanlist" for "2oasA01"
Write scan list by auto on 03 Sep 2007 12:03
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2oasA01.scanlist" for domain "2oasA01"
Update comment by auto on 03 Sep 2007 10:10
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:31
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:36
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:32
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 18:21
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 14:21
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 10:14
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 02:27
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 22:11
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 18:14
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 14:15
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 11:40
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 06:14
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 03:31
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Aug 2007 20:06
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 16:16
Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 10:11
Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 06:32
Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 02:36
Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 22:15
Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 14:42
Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 09:04
Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 02:23
Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 22:28
Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 18:33
Waiting for 1343 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 14:49
Waiting for 1412 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 10:14
Waiting for 1494 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 08:12
Waiting for 1549 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 02:21
Waiting for 1622 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 22:21
Waiting for 1678 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Flow stage update by auto on 27 Aug 2007 22:14
No satisfactory AssignClose result found.
Flow stage update by auto on 27 Aug 2007 22:05
No in_process hits for Domain "2oasA01" ready to be processed
Flow stage update by auto on 27 Aug 2007 22:05
NW result present for Domain "2oasA01"
Flow stage update by auto on 19 Aug 2007 10:12
All required files are present for Domain "2oasA01"
Flow stage update by auto on 16 Aug 2007 17:14
Beginning processing for Domain "2oasA01"
Insertion by auto on 16 Aug 2007 14:08
Final ChopClose added based on similarity with "2oasB"
