CATH Domain: 2oa2A01 XML data for domain: 2oa2A01

Molscript image for 2oa2A01
2oa2A01
PDB coordinates for domain 2oa2A01

PDB 2oa2, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.60 Sandwich
2.60.120 Jelly Rolls
2.60.120.10 Jelly Rolls Gene3D
2.60.120.10.19
2.60.120.10.19.1
2.60.120.10.19.1.1
2.60.120.10.19.1.1.1
2.60.120.10.19.1.1.1.1

[top]
Segment boundaries for domain 2oa2A01

Chopping figure for domain 2oa2A01
DomainStart PDB ResidueStop PDB Residue
2oa2A01 169 289

Structural Neighbourhood (12 entries)

There are 12 matching structural neighberhood comparisons for CATH ID 2.60.120.10.19.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 12 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1o4tA00 83.51 Thermotoga maritimaPutative uncharacterized protein 2.60.120.10 115 13 76 3.23 4.22
1vj2A00 82.51 Thermotoga maritimaPutative uncharacterized protein 2.60.120.10 114 13 78 2.63 3.37
1yhfA01 81.08 Hypothetical cytosolic proteinStreptococcus pyogenes serotype M1 2.60.120.10 105 17 80 3.45 4.29
2pfwA00 80.82 Cupin 2 domain-containing proteinShewanella frigidimarina NCIMB 400Cupin 2, conserved barrel domain protein 2.60.120.10 109 11 83 3.49 4.18
2ozjA00 80.74 Desulfitobacterium hafniense DCB-2Cyclic nucleotide-binding protein 2.60.120.10 104 15 78 2.59 3.30
2opkB01 79.70 Ralstonia eutropha JMP134Cupin 2 domain-containing proteinPutative uncharacterized protein 2.60.120.10 90 12 77 3.81 4.91
2q30A01 79.53 Desulfovibrio desulfuricans subsp. desulfuricans str. G20Putative uncharacterized protein 2.60.120.10 85 16 72 2.99 4.10
1y9qA02 79.35 Vibrio choleraeTranscriptional regulator, HTH_3 family 2.60.120.10 90 13 74 3.17 4.24
2i45D00 77.63 Neisseria meningitidis serogroup BPutative uncharacterized protein 2.60.120.10 96 15 80 2.95 3.67
3bcwA01 76.79 Bordetella bronchisepticaPutative uncharacterized protein 2.60.120.10 93 12 71 3.41 4.74
2pytA00 76.72 Ethanolamine utilization protein EutQSalmonella enterica subsp. enterica serovar TyphimuriumEthanolamine utilization protein eutQ 2.60.120.10 118 10 74 3.70 4.96
1nlqE00 71.26 Nucleoplasmin-like proteinNucleophosmin 3Histone bindingDrosophila melanogasterSUMO binding 2.60.120.340 98 2 65 3.05 4.66
[1]
Displaying entries 1 to 12 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2oa2A01
NIEDETKRNRAFRRALWTGDHLQVTLSIQVGEDIGLEIHPHLDQFLRVEEGRGLVQGHRQDNLHFQEEVFDDYAILIPAG
TWHNVRNTGNRPLKLYSIYAPPQHPHGTVHETKAIAAA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2oa2A01
NIEDETKRNRAFRRALWTGDHLQVTLXSIQVGEDIGLEIHPHLDQFLRVEEGRGLVQXGHRQDNLHFQEEVFDDYAILIP
AGTWHNVRNTGNRPLKLYSIYAPPQHPHGTVHETKAIAXAAEEHHHL
BLAST against CATH

[top]
Domain History Events (117)

Domain assigned by cuff on 14 Feb 2008 13:40

i agree, same superfamily

Domain scan prc pfamcath by auto on 25 Sep 2007 13:02

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 447 results for 2oa2A01

Domain assignment manual match h by rupa on 03 Sep 2007 11:39

High ssap score, same fold, same cupin superfamily (pfam).

Homcheck review by rupa on 03 Sep 2007 11:39

High ssap score, same fold, same cupin superfamily (pfam).

Flow stage update by rupa on 03 Sep 2007 11:39

High ssap score, same fold, same cupin superfamily (pfam).

Homcheck allotment by rupa on 03 Sep 2007 11:37

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by rupa on 03 Sep 2007 11:37

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 02 Sep 2007 05:43

Domain "2oa2A01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 02 Sep 2007 05:43

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2oa2A01

Flow stage update by auto on 02 Sep 2007 03:47

Retrieved PRC_PFAMCATH results for job ID SID9103808608480832 and results inserted.

Update comment by auto on 01 Sep 2007 19:01

PRC_PFAMCATH job SID9103808608480832 is not yet finished.

Prc pfamcath submit by auto on 01 Sep 2007 18:57

The entry "2oa2A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 01 Sep 2007 18:57

The entry "2oa2A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 01 Sep 2007 18:35

Retrieved SSAP results for job ID SID0493949707718224 and results inserted.

Domain scan ssap cath by auto on 01 Sep 2007 18:34

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 426 results for 2oa2A01

Update comment by auto on 31 Aug 2007 20:21

SSAP job SID0493949707718224 is not yet finished.

Flow stage update by auto on 31 Aug 2007 20:12

The entry "2oa2A01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 31 Aug 2007 20:12

The entry "2oa2A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 30 Aug 2007 16:52

Giving up on SSAP job SID7777937023893560 because submission time of Tue Aug 28 14:55:43 2007 is more than 172800 seconds older than current time (Thu Aug 30 16:52:07 2007).

Update comment by auto on 28 Aug 2007 15:02

SSAP job SID7777937023893560 is not yet finished.

Ssap cath submit by auto on 28 Aug 2007 14:55

The entry "2oa2A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Aug 2007 14:55

The entry "2oa2A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Aug 2007 10:21

Giving up on SSAP job SID5073577750581632 because submission time of Sun Aug 26 09:14:10 2007 is more than 172800 seconds older than current time (Tue Aug 28 10:21:14 2007).

Update comment by auto on 26 Aug 2007 09:23

SSAP job SID5073577750581632 is not yet finished.

Flow stage update by auto on 26 Aug 2007 09:14

The entry "2oa2A01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 26 Aug 2007 09:14

The entry "2oa2A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 26 Aug 2007 02:59

Giving up on SSAP job SID2588993766042048 because submission time of Thu Aug 23 22:36:52 2007 is more than 172800 seconds older than current time (Sun Aug 26 02:59:05 2007).

Update comment by auto on 23 Aug 2007 22:47

SSAP job SID2588993766042048 is not yet finished.

Ssap cath submit by auto on 23 Aug 2007 22:36

The entry "2oa2A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Aug 2007 22:36

The entry "2oa2A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Aug 2007 19:39

Giving up on SSAP job SID6093827284558080 because submission time of Tue Aug 21 10:58:31 2007 is more than 172800 seconds older than current time (Thu Aug 23 19:39:19 2007).

Update comment by auto on 21 Aug 2007 11:39

SSAP job SID6093827284558080 is not yet finished.

Ssap cath submit by auto on 21 Aug 2007 10:58

The entry "2oa2A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 21 Aug 2007 10:58

The entry "2oa2A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 21 Aug 2007 08:19

Giving up on SSAP job SID9515626046453692 because submission time of Sun Aug 19 07:38:00 2007 is more than 172800 seconds older than current time (Tue Aug 21 08:19:50 2007).

Update comment by auto on 19 Aug 2007 08:30

SSAP job SID9515626046453692 is not yet finished.

Ssap cath submit by auto on 19 Aug 2007 07:38

The entry "2oa2A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 19 Aug 2007 07:38

The entry "2oa2A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 19 Aug 2007 03:38

Giving up on SSAP job SID9941930203329216 because submission time of Thu Aug 16 23:29:37 2007 is more than 172800 seconds older than current time (Sun Aug 19 03:38:21 2007).

Update comment by auto on 17 Aug 2007 00:39

SSAP job SID9941930203329216 is not yet finished.

Ssap cath submit by auto on 16 Aug 2007 23:29

The entry "2oa2A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 23:29

The entry "2oa2A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 18:38

Giving up on SSAP job SID3109561019576144 because submission time of Tue Aug 14 09:10:42 2007 is more than 172800 seconds older than current time (Thu Aug 16 18:38:31 2007).

Update comment by auto on 14 Aug 2007 10:39

SSAP job SID3109561019576144 is not yet finished.

Ssap cath submit by auto on 14 Aug 2007 09:10

The entry "2oa2A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 09:10

The entry "2oa2A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 06:56

Retrieved PRC results for job ID SID3638604682175152 and inserted them into the database.

Domain scan prc cath by auto on 14 Aug 2007 06:55

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 38 results for 2oa2A01

Prc cath submit by auto on 13 Aug 2007 10:44

The entry "2oa2A01" has been submitted to the PRC webservice.

Flow stage update by auto on 13 Aug 2007 10:44

The entry "2oa2A01" has been submitted to the PRC webservice.

Flow stage update by auto on 13 Aug 2007 08:34

Retrieved HMM(SAM) results for job ID SID4077229468974392 and inserted them into the database.

Domain scan sam cath by auto on 13 Aug 2007 08:33

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 18 results for 2oa2A01

Update comment by auto on 12 Aug 2007 13:12

HMM(SAM) job SID4077229468974392 is not yet finished.

Sam cath submit by auto on 12 Aug 2007 11:57

The entry "2oa2A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 11:57

The entry "2oa2A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 04:45

Retrieved "2oa2A01" CATHEDRAL results for job ID SID6072227443336224 and inserted them into the database.

Domain scan cathedral cath by auto on 12 Aug 2007 04:43

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 430 results for 2oa2A01

Update comment by auto on 11 Aug 2007 05:59

"2oa2A01" CATHEDRAL job SID6072227443336224 is not yet finished.

Cathedral cath submit by auto on 11 Aug 2007 04:29

The entry "2oa2A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 11 Aug 2007 04:29

The entry "2oa2A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 11 Aug 2007 02:35

ScanList with 9778 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2oa2A01.scanlist" for "2oa2A01"

Write scan list by auto on 11 Aug 2007 02:35

Writing ScanList containing 9778 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2oa2A01.scanlist" for domain "2oa2A01"

Update comment by auto on 10 Aug 2007 14:33

Waiting for 984 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 10:32

Waiting for 1052 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 06:45

Waiting for 1095 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 02:47

Waiting for 1146 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 22:33

Waiting for 1198 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 19:14

Waiting for 1261 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 14:59

Waiting for 1336 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 10:58

Waiting for 1377 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 06:45

Waiting for 1412 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 02:52

Waiting for 1457 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 22:35

Waiting for 1505 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 18:43

Waiting for 1577 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 14:42

Waiting for 1645 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 11:05

Waiting for 1704 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 06:51

Waiting for 1742 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 02:58

Waiting for 1792 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 22:46

Waiting for 1837 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 19:33

Waiting for 1893 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 15:15

Waiting for 1975 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 10:44

Waiting for 2056 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 06:57

Waiting for 2116 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 02:50

Waiting for 2178 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 22:37

Waiting for 2230 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 18:50

Waiting for 2293 new domains (example : 1t6pD03) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 14:44

Waiting for 2348 new domains (example : 1rqrB02) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 11:22

Waiting for 2404 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 09:18

Waiting for 2415 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 02:16

Waiting for 2528 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 19:05

Waiting for 2652 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 07:23

Waiting for 2828 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 03:14

Waiting for 2883 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 22:51

Waiting for 2924 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 19:08

Waiting for 2965 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 15:11

Waiting for 3034 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 11:11

Waiting for 3098 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 07:00

Waiting for 3152 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 03:10

Waiting for 3197 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 22:57

Waiting for 3216 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 19:53

Waiting for 3206 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 15:50

Waiting for 3198 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 11:01

Waiting for 3055 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 07:04

Waiting for 3126 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 03:02

Waiting for 3204 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 22:47

Waiting for 3254 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 19:32

Waiting for 3282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 15:25

Waiting for 3339 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 11:06

Waiting for 3395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 07:05

Waiting for 3471 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 03:04

Waiting for 3542 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Flow stage update by auto on 02 Aug 2007 02:39

No satisfactory AssignClose result found.

Flow stage update by auto on 02 Aug 2007 02:36

No in_process hits for Domain "2oa2A01" ready to be processed

Flow stage update by auto on 02 Aug 2007 02:36

NW result present for Domain "2oa2A01"

Flow stage update by auto on 12 Jul 2007 02:02

All required files are present for Domain "2oa2A01"

Flow stage update by auto on 11 Jul 2007 16:04

Beginning processing for Domain "2oa2A01"

Insertion by cuff on 11 Jul 2007 16:02

nice chopping