CATH Domain: 2o99B00 XML data for domain: 2o99B00

Molscript image for 2o99B00
2o99B00
PDB coordinates for domain 2o99B00

PDB 2o99, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.450 Beta-Lactamase
3.30.450.40 Gene3D
3.30.450.40.2
3.30.450.40.2.1
3.30.450.40.2.1.1
3.30.450.40.2.1.1.3
3.30.450.40.2.1.1.3.1

[top]
Segment boundaries for domain 2o99B00

Chopping figure for domain 2o99B00
DomainStart PDB ResidueStop PDB Residue
2o99B00 1 178

Structural Neighbourhood (6 entries)

There are 6 matching structural neighberhood comparisons for CATH ID 3.30.450.40.2.1.1.3.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 6 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2ia2A02 88.70 Rhodococcus sp. DK17PcaR 3.30.450.40 179 22 92 2.51 2.71
1ysqA00 88.67 Specific transcriptional repressor activityNegative regulation of transcription, DNA-dependentHTH-type transcriptional regulator yiaJEscherichia coli K-12 3.30.450.40 181 28 91 2.64 2.88
1yspA00 88.21 Specific transcriptional repressor activitySequence-specific DNA binding transcription factor activityNegative regulation of gene-specific transcriptionTranscriptional regulator kdgREscherichia coli K-12 3.30.450.40 161 28 90 2.18 2.42
2o0yB02 86.98 Rhodococcus jostii RHA1Transcriptional regulator 3.30.450.40 176 24 92 3.50 3.78
3d3oA00 83.81 Putative transcriptional regulator (IcIR family)Acinetobacter sp. ADP1 3.30.450.40 167 13 93 3.63 3.88
3bjnA00 83.67 Transcriptional regulator, putativeVibrio cholerae 3.30.450.40 151 17 83 3.69 4.42
[1]
Displaying entries 1 to 6 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2o99B00
GHSRNLLAIVHPILRNLEESGETVNAVLDQSDHEAIIIDQVQCTHLRSAPIGGKLPHASGAGKAFLAQLSEEQVTKLLHR
KGLHAYTHATLVSPVHLKEDLAQTRKRGYSFDDEEHALGLRCLAACIFDEHREPFAAISISGPISRITDDRVTEFGAVIK
AAKEVTLAYGG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2o99B00
GHXSRNLLAIVHPILRNLXEESGETVNXAVLDQSDHEAIIIDQVQCTHLXRXSAPIGGKLPXHASGAGKAFLAQLSEEQV
TKLLHRKGLHAYTHATLVSPVHLKEDLAQTRKRGYSFDDEEHALGLRCLAACIFDEHREPFAAISISGPISRITDDRVTE
FGAXVIKAAKEVTLAYGGXRGS
BLAST against CATH

[top]
Domain History Events (13)

Domain assigned by auto on 15 Aug 2007 04:51

Assigning to "3.30.450.40" based on similarity with "2o9aC00"

Flow stage update by auto on 15 Aug 2007 04:36

No in_process hits for Domain "2o99B00" ready to be processed

Update comment by auto on 15 Aug 2007 04:01

Domain "2o99B00" hits Domain "2o99A00" (95.6043956043956% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 03:23

Domain "2o99B00" hits Domain "2o99C00" (95.6043956043956% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 02:40

Domain "2o99B00" hits Domain "2o9aC00" (95.6043956043956% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 01:41

Domain "2o99B00" hits Domain "2o9aA00" (95.6043956043956% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 00:09

Domain "2o99B00" hits Domain "2o9aD00" (95.6043956043956% over 100%) which is currently in process

Update comment by auto on 14 Aug 2007 22:51

Domain "2o99B00" hits Domain "2o9aB00" (95.6043956043956% over 100%) which is currently in process

Flow stage update by auto on 02 Aug 2007 02:36

Domain "2o99B00" hits Domain "2o99D00" (95.6043956043956% over 100%) which is currently in process

Flow stage update by auto on 02 Aug 2007 02:36

NW result present for Domain "2o99B00"

Flow stage update by auto on 16 Jul 2007 22:39

All required files are present for Domain "2o99B00"

Flow stage update by auto on 14 Jul 2007 21:06

Beginning processing for Domain "2o99B00"

Insertion by auto on 14 Jul 2007 20:29

Final ChopClose added based on similarity with "1td5A"