Domain assigned by auto on 29 Dec 2007 14:14
Assigning to "2.40.10.10" based on similarity with "2nwnA01"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2o8tA01 | 16 | 27 |
| 2o8tA01 | 121 | 232 |
| 2o8tA02 | 28 | 120 |
| 2o8tA02 | 233 | 242 |
There are 10 matching structural neighberhood comparisons for CATH ID 2.40.10.10.47.1.1.1.1 (SIMAX score < 5)
>pdb|2o8tA01 IIGGEFTTIENQIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADP QWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVS
Assigning to "2.40.10.10" based on similarity with "2nwnA01"
No in_process hits for Domain "2o8tA01" ready to be processed
NW result present for Domain "2o8tA01"
All required files are present for Domain "2o8tA01"
Beginning processing for Domain "2o8tA01"
Final ChopClose added based on similarity with "2nwnA"