Domain assigned by cuff on 18 Feb 2008 14:53
i agree - same superfamily
CATH Domain: 2o8rB03
2o8rB03
PDB 2o8r, Chain B, Domain 3
Segment boundaries for domain 2o8rB03
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2o8rB01 | 11 | 111 |
| 2o8rB01 | 307 | 319 |
| 2o8rB02 | 112 | 305 |
| 2o8rB03 | 320 | 503 |
| 2o8rB03 | 593 | 596 |
| 2o8rB04 | 504 | 592 |
| 2o8rB04 | 597 | 616 |
| 2o8rB04 | 621 | 690 |
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|2o8rB03 PEPLLSKHLEQAPSLEGIRRKDYLIHVPYYTYDYVVRLLEAAISPDVSEIRLTQYRVAENSSIISALEAAAQSGKKVSVF VELKARFDEENNLRLSERRRSGIRIVYSPGLKVHAKTALILYHTPAGERPQGIALLSTGNFNETTARIYSDTTLTANTDI VHDVYRLFRILDGDPEPARLEHS
Domain History Events (58)
Domain assignment manual match h by rupa on 12 Sep 2007 12:06
Very high ssap score, same fold and similar phospholipase function.
Homcheck review by rupa on 12 Sep 2007 12:06
Very high ssap score, same fold and similar phospholipase function.
Flow stage update by rupa on 12 Sep 2007 12:06
Very high ssap score, same fold and similar phospholipase function.
Homcheck allotment by rupa on 12 Sep 2007 12:02
User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by rupa on 12 Sep 2007 12:02
User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 11 Sep 2007 20:05
Domain "2o8rB03" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 11 Sep 2007 20:04
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2o8rB03
Flow stage update by auto on 11 Sep 2007 19:29
Retrieved PRC_PFAMCATH results for job ID SID5008356000619912 and results inserted.
Domain scan prc pfamcath by auto on 11 Sep 2007 19:28
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 6 results for 2o8rB03
Update comment by auto on 11 Sep 2007 15:57
PRC_PFAMCATH job SID5008356000619912 is not yet finished.
Flow stage update by auto on 11 Sep 2007 15:50
The entry "2o8rB03" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 11 Sep 2007 15:50
The entry "2o8rB03" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 11 Sep 2007 14:40
Retrieved SSAP results for job ID SID5827711116760116 and results inserted.
Domain scan ssap cath by auto on 11 Sep 2007 14:39
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 989 results for 2o8rB03
Update comment by auto on 09 Sep 2007 23:01
SSAP job SID5827711116760116 is not yet finished.
Ssap cath submit by auto on 09 Sep 2007 22:17
The entry "2o8rB03" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 22:17
The entry "2o8rB03" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 19:50
Giving up on SSAP job SID5495845789355648 because submission time of Wed Sep 5 16:08:08 2007 is more than 345600 seconds older than current time (Sun Sep 9 19:50:35 2007).
Update comment by auto on 05 Sep 2007 19:35
SSAP job SID5495845789355648 is not yet finished.
Ssap cath submit by auto on 05 Sep 2007 16:08
The entry "2o8rB03" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 16:08
The entry "2o8rB03" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 09:01
Retrieved PRC results for job ID SID5400950010460608 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 09:00
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 4 results for 2o8rB03
Prc cath submit by auto on 05 Sep 2007 03:46
The entry "2o8rB03" has been submitted to the PRC webservice.
Flow stage update by auto on 05 Sep 2007 03:46
The entry "2o8rB03" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Sep 2007 22:22
Retrieved HMM(SAM) results for job ID SID0573941487649600 and inserted them into the database.
Domain scan sam cath by auto on 04 Sep 2007 22:21
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 2o8rB03
Update comment by auto on 04 Sep 2007 11:49
HMM(SAM) job SID0573941487649600 is not yet finished.
Sam cath submit by auto on 04 Sep 2007 09:57
The entry "2o8rB03" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 09:57
The entry "2o8rB03" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 01:38
Retrieved "2o8rB03" CATHEDRAL results for job ID SID4933544132290576 and inserted them into the database.
Domain scan cathedral cath by auto on 04 Sep 2007 01:35
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 513 results for 2o8rB03
Cathedral cath submit by auto on 03 Sep 2007 14:02
The entry "2o8rB03" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 14:02
The entry "2o8rB03" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 12:02
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2o8rB03.scanlist" for "2o8rB03"
Write scan list by auto on 03 Sep 2007 12:02
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2o8rB03.scanlist" for domain "2o8rB03"
Update comment by auto on 03 Sep 2007 10:10
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:31
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:36
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:32
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 18:21
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 14:21
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 10:14
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 02:27
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 22:11
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 18:14
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 14:15
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 11:40
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 06:14
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 03:31
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Aug 2007 20:05
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Flow stage update by auto on 31 Aug 2007 19:59
No satisfactory AssignClose result found.
Flow stage update by auto on 31 Aug 2007 19:48
No in_process hits for Domain "2o8rB03" ready to be processed
Flow stage update by auto on 31 Aug 2007 19:48
NW result present for Domain "2o8rB03"
Flow stage update by auto on 24 Aug 2007 10:05
All required files are present for Domain "2o8rB03"
Flow stage update by auto on 23 Aug 2007 18:40
Beginning processing for Domain "2o8rB03"
Insertion by cuff on 23 Aug 2007 11:57
nice chopping
