CATH Domain: 2o8rA03 XML data for domain: 2o8rA03

Molscript image for 2o8rA03
2o8rA03
PDB coordinates for domain 2o8rA03

PDB 2o8r, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.870 Endonuclease; Chain A
3.30.870.10 Endonuclease Chain A Gene3D
3.30.870.10.6
3.30.870.10.6.2
3.30.870.10.6.2.1
3.30.870.10.6.2.1.1
3.30.870.10.6.2.1.1.1

[top]
Segment boundaries for domain 2o8rA03

Chopping figure for domain 2o8rA03
DomainStart PDB ResidueStop PDB Residue
2o8rA01 4 317
2o8rA02 322 507
2o8rA03 510 689

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.870.10.6.2.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1byrA00 81.13 EndonucleaseEscherichia coli 3.30.870.10 152 15 71 2.78 3.87
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2o8rA03
ARYNGEAITNLIEREIENVKRGKRGYLLKNGLQDKNVITQLYRASEAGVEIDLIVRGICCLVPDPQSRNIRVTRLVDYLE
HSRIWCFHNGGKEEVFISSADWKRNLYNRIETACPVLDPTLRREIIDILEIQLRDNIKACRIDSSLNNIYKHNSDEKPVR
AQAAIYRYLKGKEE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2o8rA03
ARYNXGEAITNLIEREIENVKRGKRGYXLLKXNGLQDKNVITQLYRASEAGVEIDLIVRGICCLVPDXPQSRNIRVTRLV
DXYLEHSRIWCFHNGGKEEVFISSADWXKRNLYNRIETACPVLDPTLRREIIDILEIQLRDNIKACRIDSSLNNIYKHNS
DEKPVRAQAAIYRYLKGKEE
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 18 Feb 2008 14:58

Assigning to "3.30.870.10" based on similarity with "2o8rB04"

Flow stage update by auto on 18 Feb 2008 14:45

No in_process hits for Domain "2o8rA03" ready to be processed

Update comment by auto on 06 Sep 2007 22:06

Domain "2o8rA03" hits Domain "2o8rB04" (92.7777777777778% over 89.5833333333333%) which is currently in process

Flow stage update by auto on 06 Sep 2007 22:05

Domain "2o8rA03" hits Domain "2o8rB04" (92.7777777777778% over 89.5833333333333%) which is currently in process

Flow stage update by auto on 06 Sep 2007 22:05

NW result present for Domain "2o8rA03"

Flow stage update by auto on 04 Sep 2007 14:04

All required files are present for Domain "2o8rA03"

Flow stage update by auto on 03 Sep 2007 20:09

Beginning processing for Domain "2o8rA03"

Insertion by cuff on 03 Sep 2007 14:13

nice chopping