CATH Domain: 2o8qA00 XML data for domain: 2o8qA00

Molscript image for 2o8qA00
2o8qA00
PDB coordinates for domain 2o8qA00

PDB 2o8q, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.60 Sandwich
2.60.120 Jelly Rolls
2.60.120.10 Jelly Rolls Gene3D
2.60.120.10.24
2.60.120.10.24.1
2.60.120.10.24.1.1
2.60.120.10.24.1.1.1
2.60.120.10.24.1.1.1.1

Segment boundaries for domain 2o8qA00

Chopping figure for domain 2o8qA00
DomainStart PDB ResidueStop PDB Residue
2o8qA00 0 128

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 2.60.120.10.24.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2opkB01 81.04 Ralstonia eutropha JMP134Cupin 2 domain-containing proteinPutative uncharacterized protein 2.60.120.10 90 15 69 2.92 4.19
2q30A01 77.86 Desulfovibrio desulfuricans subsp. desulfuricans str. G20Putative uncharacterized protein 2.60.120.10 85 20 67 3.12 4.64
Displaying entries 1 to 2 (page 1 of 1)


Domain ATOM Sequence

>pdb|2o8qA00
GKLQTTIQHEPKDGSGFDRREFFEYRDTGVNEATGGFGAHVIRAIPPTWHTHTVGFQLFYVLRGWVEFEYEDIGAVLEAG
GSAFQPPGVRHRELRHSDDLEVLEIVSPAGFATSVVDLE    

Domain COMBS Sequence

>pdb|2o8qA00
GXKLQTTIQHEPKDGSGFDRGLREFFEYRDTGVNEATGGXFGAHVIRAIPGKEAKPTWHTHTVGFQLFYVLRGWVEFEYE
DIGAVXLEAGGSAFQPPGVRHRELRHSDDLEVLEIVSPAGFATSVVDLEEARKP    

Domain History Events (12)

Domain assigned by auto on 14 Feb 2008 14:26

Assigning to "2.60.120.10" based on similarity with "2o8qB00"

Flow stage update by auto on 14 Feb 2008 14:13

No in_process hits for Domain "2o8qA00" ready to be processed

Update comment by auto on 03 Sep 2007 20:10

Domain "2o8qA00" hits Domain "2o8qB00" (97.7611940298507% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2o8qA00" hits Domain "2o8qB00" (97.7611940298507% over 100%) which is currently in process

Update comment by auto on 11 Aug 2007 14:42

Domain "2o8qA00" hits Domain "2o8qB00" (97.7611940298507% over 100%) which is currently in process

Update comment by auto on 10 Aug 2007 23:26

Domain "2o8qA00" hits Domain "2o8qB00" (97.7611940298507% over 100%) which is currently in process

Update comment by auto on 02 Aug 2007 02:39

Domain "2o8qA00" hits Domain "2o8qB00" (97.7611940298507% over 100%) which is currently in process

Flow stage update by auto on 02 Aug 2007 02:36

Domain "2o8qA00" hits Domain "2o8qB00" (97.7611940298507% over 100%) which is currently in process

Flow stage update by auto on 02 Aug 2007 02:36

NW result present for Domain "2o8qA00"

Flow stage update by auto on 12 Jul 2007 02:02

All required files are present for Domain "2o8qA00"

Flow stage update by auto on 11 Jul 2007 16:04

Beginning processing for Domain "2o8qA00"

Insertion by cuff on 11 Jul 2007 16:03

nice chopping