CATH Domain: 2o5aA01 XML data for domain: 2o5aA01

Molscript image for 2o5aA01
2o5aA01
PDB coordinates for domain 2o5aA01

PDB 2o5a, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.460 Beta Polymerase; domain 2
3.30.460.10 Beta Polymerase, domain 2 Gene3D
3.30.460.10.14
3.30.460.10.14.1
3.30.460.10.14.1.1
3.30.460.10.14.1.1.1
3.30.460.10.14.1.1.1.1

Segment boundaries for domain 2o5aA01

Chopping figure for domain 2o5aA01
DomainStart PDB ResidueStop PDB Residue
2o5aA01 2 108

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.460.10.14.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1cc8A00 75.85 Copper chaperone activityMetal homeostasis factor ATX1Protein bindingCytosolCopper ion transport 3.30.70.100 72 5 57 2.87 5.00
Displaying entries 1 to 1 (page 1 of 1)


Domain ATOM Sequence

>pdb|2o5aA01
SNQELLQLAVNAVDDKKAEQVVALNKGISLDFFLICHGNSEKQVQAIAHELKKVAQEQGIEIKRLEGYEQARWVLIDLGD
VVVHVFHKDERAYYNLEKLWP    

Domain COMBS Sequence

>pdb|2o5aA01
XSNQELLQLAVNAVDDKKAEQVVALNXKGISLIADFFLICHGNSEKQVQAIAHELKKVAQEQGIEIKRLEGYEQARWVLI
DLGDVVVHVFHKDERAYYNLEKLWGDAP    

Domain History Events (14)

Domain assigned by auto on 15 Apr 2008 14:22

Assigning to "3.30.460.10" based on similarity with "2o5aB01"

Flow stage update by auto on 15 Apr 2008 14:20

No in_process hits for Domain "2o5aA01" ready to be processed

Update comment by auto on 15 Apr 2008 14:14

Domain "2o5aA01" hits Domain "2o5aB01" (98.1481481481482% over 100%) which is currently in process

Update comment by auto on 15 Apr 2008 14:05

Domain "2o5aA01" hits Domain "2id1A01" (36.1904761904762% over 97.2222222222222%) which is currently in process

Update comment by auto on 03 Sep 2007 20:10

Domain "2o5aA01" hits Domain "2id1B01" (36.1904761904762% over 97.2222222222222%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2o5aA01" hits Domain "2id1B01" (36.1904761904762% over 97.2222222222222%) which is currently in process

Update comment by auto on 11 Aug 2007 14:42

Domain "2o5aA01" hits Domain "2id1B01" (36.1904761904762% over 97.2222222222222%) which is currently in process

Update comment by auto on 10 Aug 2007 23:26

Domain "2o5aA01" hits Domain "2id1B01" (36.1904761904762% over 97.2222222222222%) which is currently in process

Update comment by auto on 01 Aug 2007 19:10

Domain "2o5aA01" hits Domain "2id1B01" (36.1904761904762% over 97.2222222222222%) which is currently in process

Flow stage update by auto on 01 Aug 2007 19:04

Domain "2o5aA01" hits Domain "2id1B01" (36.1904761904762% over 97.2222222222222%) which is currently in process

Flow stage update by auto on 01 Aug 2007 19:03

NW result present for Domain "2o5aA01"

Flow stage update by auto on 12 Jul 2007 02:02

All required files are present for Domain "2o5aA01"

Flow stage update by auto on 10 Jul 2007 14:03

Beginning processing for Domain "2o5aA01"

Insertion by auto on 10 Jul 2007 14:02

Final ChopClose added based on similarity with "2id1A"